DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG2616

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:341 Identity:96/341 - (28%)
Similarity:149/341 - (43%) Gaps:74/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQ-------------------IGPNGERM-- 61
            |...|.::|:.....:|....:.|||::|||:|:||                   .||||..:  
  Fly    87 QIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELAS 151

  Fly    62 ------YNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKLTANDYF-------------- 106
                  ::|.:|...|..:.||...::.|.|..::...|...|...|.:.|              
  Fly   152 LRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNK 216

  Fly   107 ----RHKLTTKDGK--LPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVE 165
                || |..:|.|  ||....|::|..|....:.|.:|:||::.:|| |.|...|..|      
  Fly   217 SQEPRH-LEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQ-AQRQTYAQML------ 273

  Fly   166 KVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSG-EAVFWCS 229
                 |....::..:|::||::|:..|.||||.||.||:|::.:|     ::|.|.| :..|..|
  Fly   274 -----QFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESL-----KQNLGHGSQPSFSLS 328

  Fly   230 FLAGLAAGSTAALAVNPFDVVKTRLQ------AIKKADGEKEF--KGISDCITKTLKHEGPTAFF 286
            ||||:.||:.||:...|||||||..|      .|......::|  |.....:|...:..|....|
  Fly   329 FLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLF 393

  Fly   287 KGGLCRMIVIAPLFGI 302
            .|...|::.:||...|
  Fly   394 AGCGPRLLKVAPACAI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 27/121 (22%)
Mito_carr 115..213 CDD:278578 32/99 (32%)
Mito_carr 226..307 CDD:278578 29/85 (34%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 28/119 (24%)
Mito_carr 230..321 CDD:278578 33/107 (31%)
Mito_carr 321..425 CDD:278578 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.