DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG6893

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:191 Identity:47/191 - (24%)
Similarity:81/191 - (42%) Gaps:32/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 AGGLAGAFQIIVTTPMELLKIQM----QDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGL 185
            :||:|||.....|.|.:|::.:|    :|.|                .|:.| .|.|:..|...|
  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRG----------------MASNL-QQAIRTHGFISL 67

  Fly   186 YKGIGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVV 250
            |.|:.|..||.:|::.:.|.|:    ::|....|  ..|......|....||..|.:...|.:::
  Fly    68 YDGLSAQLLRQLTYTSMRFHLY----EMGKEHLD--DPAGLLDKVLVAALAGCVAGVVGTPMELI 126

  Fly   251 KTRLQAIKKADGEK--EFKGISDCITKTLKHEGPTAFFKGGLCRM-IVIAPLFGIAQTVYY 308
            .||:|..:....|.  .::.:.|.:.:..:.||.|..:.|  |.: .:.:.|..|:|...|
  Fly   127 NTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSG--CFLSFMRSSLITISQNAAY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578
Mito_carr 115..213 CDD:278578 25/91 (27%)
Mito_carr 226..307 CDD:278578 18/83 (22%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 26/96 (27%)
Mito_carr 98..192 CDD:395101 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.