DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and SCaMC

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:319 Identity:88/319 - (27%)
Similarity:140/319 - (43%) Gaps:55/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNI 89
            ::.|||||.:..||..|||.:|..||.|.     :||  .:.:|........|...|:||:|:|:
  Fly   289 LVAGGIAGAVSRTCTAPLDRIKVYLQVQT-----QRM--GISECMHIMLNEGGSRSMWRGNGINV 346

  Fly    90 LLITPEKAIKLTANDYFRHKLTTKDG--KLPLTSQMVAGGLAGAFQIIVTTPMELLK--IQMQDA 150
            |.|.||.|.|..|.:..:..:...||  ::.:..:..||..||.....:..|||:||  :.::..
  Fly   347 LKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT 411

  Fly   151 GRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGP 215
            |:.|..|..|.|             :.|.:|:...|:|.....|..:.::.|...::.||.....
  Fly   412 GQYAGIADAAVK-------------IYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYI 463

  Fly   216 RRNDGSGEAVFWCSFLAGLAAGSTAA----LAVNPFDVVKTRLQA----------------IKKA 260
            ..:|.:.:.    |||..||.|||::    |...|..:|:|||||                :|.:
  Fly   464 ANHDNNEQP----SFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSS 524

  Fly   261 D---GEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVY-YLGVAEGL 315
            |   ||:...|:   ..|.::.||.|..::|.....:.:.|...|:..|| |...|.|:
  Fly   525 DAHSGEETMTGL---FRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 25/76 (33%)
Mito_carr 115..213 CDD:278578 23/101 (23%)
Mito_carr 226..307 CDD:278578 28/103 (27%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 30/87 (34%)
Mito_carr 375..463 CDD:278578 22/100 (22%)
Mito_carr 470..581 CDD:278578 33/118 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.