DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and Bmcp

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:300 Identity:82/300 - (27%)
Similarity:130/300 - (43%) Gaps:49/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 INGGIAGIIGVTCVFPLDLVKTRL--QNQQIGPNGERM-YNSMFDCFRKTYKAEGYFGMYRGSGV 87
            :.||:|.|......||:|..||||  |.|:|..:..:: |..|.|.|.|..:.||...:|.|...
  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75

  Fly    88 NILLITPEKAIKL--------TANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLK 144
            .:|.......||.        .||:  |..|..:||...:.|.::....|||....:..|.::||
  Fly    76 AVLRQATYGTIKFGTYYTLKKLANE--RGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLK 138

  Fly   145 IQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLF-- 207
            ::||..|:......|.           ...::.|.:|:.||::|:|.|..|.|..:.:..|::  
  Fly   139 VRMQVHGKGQHKGLLG-----------CFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDF 192

  Fly   208 ---ATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQ-----------AIK 258
               ..:|..|    |..|.. |..||:|.|.    :|:|..|.||::|||.           .:.
  Fly   193 CKLQLMNAFG----DHVGNH-FISSFIASLG----SAIASTPIDVIRTRLMNQRPVSITMNGVVT 248

  Fly   259 KADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAP 298
            .|...|.:.|..||..:|:::||..|.:||.:...:.:.|
  Fly   249 AAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 26/87 (30%)
Mito_carr 115..213 CDD:278578 23/102 (23%)
Mito_carr 226..307 CDD:278578 24/83 (29%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 26/85 (31%)
Mito_carr <132..199 CDD:278578 17/77 (22%)
Mito_carr 204..303 CDD:278578 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.