DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG18418

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:128/281 - (45%) Gaps:28/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGY 78
            |.|.:|.:      ||.:|::....|.||||:|||:|..  |..|.|.|.:.|:...|..|.||.
  Fly    13 PTHMKFVM------GGTSGMLATCIVQPLDLLKTRMQIS--GTLGTREYKNSFEVLSKVLKNEGI 69

  Fly    79 FGMYRGSGVNILLITPEKAIKLTAN----DYFRHKLTTKDGKLP-LTSQMVAGGLAGAFQIIVTT 138
            ..:|.|....:|......:.|:...    |::|...    |..| :.:.|..|.:||||..:...
  Fly    70 LSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNF----GNYPSMVASMTMGIVAGAFGAMCGN 130

  Fly   139 PMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIY 203
            |.|:..|:|....|:....:...|.|.....     :::||:|:..|::|...|..|.:..:::.
  Fly   131 PAEVALIRMMSDNRLMPEDRRNYKNVGDAFV-----RIVKDEGVVALWRGCLPTVGRAMVVNMVQ 190

  Fly   204 FPLFATL-NDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFK 267
            ...::.: |.|....::|     ......|.|.:|...::...|.|:.|||:|.:|..||:.|:.
  Fly   191 LASYSLMKNQLHGYLSEG-----IPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYS 250

  Fly   268 GISDCITKTLKHEGPTAFFKG 288
            |..|.:.|.||:||..|.:||
  Fly   251 GTIDVLKKVLKNEGAFAVWKG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 24/80 (30%)
Mito_carr 115..213 CDD:278578 23/99 (23%)
Mito_carr 226..307 CDD:278578 23/63 (37%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 31/106 (29%)
PTZ00169 18..296 CDD:240302 76/276 (28%)
Mito_carr 109..205 CDD:278578 23/100 (23%)
Mito_carr 208..300 CDD:278578 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.