DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and Shawn

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:365 Identity:90/365 - (24%)
Similarity:144/365 - (39%) Gaps:84/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSATIATPLPQPQHQQFALLP-KIINGGIAGIIGVTC-VFPLDLVKTRLQNQQ------------ 53
            |.||:..|       :|.:.| :.:.....|.:...| :.|||::|||||.||            
  Fly    26 SKATMTDP-------RFRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYC 83

  Fly    54 ---------IGPNGER--------MYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKLT 101
                     .||:...        .::...|.|.|..:.||...::.|....::...|...|...
  Fly    84 NGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFV 148

  Fly   102 ANDYFRHKLTTKDGK---------------LPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAG 151
            |.:.|:.:.|....|               :|....::||.......:...:|:||::.:||  .
  Fly   149 AYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQ--S 211

  Fly   152 RVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPR 216
            :....|::.| |:.         |:::.:|:.||::|:..|.||||.||.||:..:..|     :
  Fly   212 QRMTHAEMFG-TIR---------QVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYL-----K 261

  Fly   217 RNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEK-----------EFKGIS 270
            .:.|..|..|..||.||..:||.||....|||||||..|.   ..|||           ..|.::
  Fly   262 SSFGVVEPTFSFSFAAGAISGSVAATITTPFDVVKTHEQI---EFGEKFIFSDNPPKQVATKSVA 323

  Fly   271 DCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVYYLG 310
            ..:....:..|..|.|.|...|:..:||...|..:.:..|
  Fly   324 MRLASIYRMGGVPAIFSGLGPRLFKVAPACAIMISSFEYG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 24/106 (23%)
Mito_carr 115..213 CDD:278578 27/112 (24%)
Mito_carr 226..307 CDD:278578 29/91 (32%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/119 (21%)
Mito_carr 178..265 CDD:278578 26/103 (25%)
Mito_carr 268..371 CDD:278578 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.