DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and Tyler

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:313 Identity:64/313 - (20%)
Similarity:107/313 - (34%) Gaps:99/313 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQI-------------------------------- 54
            :.::::..:.|:|....|.||::||||:|.|..                                
  Fly    46 MQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPK 110

  Fly    55 ---GPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKLTANDYFRHKLT----- 111
               .|...|......|.|.|.....|:.|::.|....::...|...|.....:|.::.|:     
  Fly   111 PGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLV 175

  Fly   112 --------TKD----------------------------GKLPLTSQMVAGGLAGAFQIIVTTPM 140
                    .||                            ..||....|.:|..:....:...||:
  Fly   176 SQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPI 240

  Fly   141 ELLKIQMQDAGRVAAAAKLAGKTVEKVSATQL---ASQLIKDKGIFGLYKGIGATGLRDVTFSII 202
            |:::|:||.               |.::..:|   ...||:..||.||::|...|.:||..||..
  Fly   241 EMVRIKMQS---------------EYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGT 290

  Fly   203 YFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQ 255
            |:.::..:     :|.....|..|..|||.|..:|:.|.....|||::.|..|
  Fly   291 YWAVYEAI-----KRAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 21/124 (17%)
Mito_carr 115..213 CDD:278578 25/100 (25%)
Mito_carr 226..307 CDD:278578 12/30 (40%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 23/124 (19%)
Mito_carr 216..302 CDD:278578 26/105 (25%)
Mito_carr 306..429 CDD:278578 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.