DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG8323

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:301 Identity:74/301 - (24%)
Similarity:124/301 - (41%) Gaps:58/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQ-QIGPNGERM--YNSMFDCFRKTYKAEGYFGMYRGSGVNI 89
            ||:|.:.......|::::|||:|.| ::...|..:  |..:.:.|....|.:|..|:.:|     
  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG----- 68

  Fly    90 LLITPEKAIKLTANDY---------FRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKI 145
              :.|....:...|.:         .|..:..:.|::.....::.|.:.|......::|..|:|.
  Fly    69 --LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKT 131

  Fly   146 QMQDAGRVAAAAKLA-GKTVEKVSATQLASQLIKDKGIFGLYKGIGA--------TGLRDVTFS- 200
            |:|.    .||.::| |......|.|....|:....|:.||::|..|        :|.:..||. 
  Fly   132 QLQS----QAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGK 192

  Fly   201 ----IIYFPLFA--TLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRL--QAI 257
                ::.:.|..  |||                 ||.|||.|||..::|:.|.||:.|||  |.:
  Fly   193 TKALLVQYDLVTQPTLN-----------------SFSAGLIAGSIMSVAITPPDVITTRLYNQGV 240

  Fly   258 KKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAP 298
            ........::|..||..|.|:.||....:||.....:.|||
  Fly   241 DAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 16/88 (18%)
Mito_carr 115..213 CDD:278578 27/113 (24%)
Mito_carr 226..307 CDD:278578 28/75 (37%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 18/84 (21%)
PTZ00169 5..293 CDD:240302 74/301 (25%)
Mito_carr 101..200 CDD:278578 23/102 (23%)
Mito_carr 206..301 CDD:278578 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.