DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and Dic3

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:293 Identity:71/293 - (24%)
Similarity:118/293 - (40%) Gaps:53/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSG 86
            ||:...||:...|.||...|:||:|.:||.|.   ..:|  .::.:..:..::..|..|.|.|..
  Fly     9 LPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQS---QADR--KTVGEILKGIHERSGILGFYNGIS 68

  Fly    87 VN----ILLITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQM 147
            .:    :...|...|:.....||..   |.|     ::|:|.....||....||..|.:::.:::
  Fly    69 ASWFRQLTYTTTRFALYEAGKDYVD---TQK-----VSSKMALATFAGIVGGIVGVPGDVVTVRL 125

  Fly   148 QDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKG------------IGATGLRDVTFS 200
            |:..::....:...|.|     .....::.|::|:..|::|            ||.....|....
  Fly   126 QNDVKLPEEKRRNYKHV-----FDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQ 185

  Fly   201 IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKE 265
            ::   ..||          |:||.| ...|.....||..|.:...|.||:||.....:..    |
  Fly   186 ML---KIAT----------GAGEGV-PLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPG----E 232

  Fly   266 FKGISDCITKTLKHEGPTAFFKGGLCRMIVIAP 298
            |.||......|.| :||.||:||.:..:|.::|
  Fly   233 FSGIGGAFLSTAK-QGPLAFYKGFIPALIRVSP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 19/80 (24%)
Mito_carr 115..213 CDD:278578 19/109 (17%)
Mito_carr 226..307 CDD:278578 23/73 (32%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 69/287 (24%)
Mito_carr 15..91 CDD:278578 19/80 (24%)
Mito_carr 93..187 CDD:278578 19/106 (18%)
Mito_carr 200..281 CDD:278578 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.