DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG4995

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:126/280 - (45%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKIINGGIAGII----GVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYR 83
            ||::...:||::    ||....|.|.||..||...  |...: |...|.|||...:.:.:.|:||
  Fly    38 PKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDD--PRNPK-YKGTFHCFRTIVQRDKFIGLYR 99

  Fly    84 GSG--------VNILLITPEKAIKLTANDYFRHKLTTKDGKLP--LTSQMVAGGLAGAFQIIVTT 138
            |..        ||.::......::..:||             |  |||...||.:||..|..|..
  Fly   100 GISSPMGGIGLVNAIVFGVYGNVQRLSND-------------PNSLTSHFFAGSIAGVAQGFVCA 151

  Fly   139 PMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIY 203
            ||||.|.::|.:.:|.:..|..|       .......::|.:||.|.:||:.||.|||:.....|
  Fly   152 PMELAKTRLQLSTQVDSGIKFTG-------PIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASY 209

  Fly   204 FPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKG 268
            |..|..|    .|:.:..|.|.   :.:||..||.::.||..|.|||||.:|| .......::.|
  Fly   210 FVSFEYL----MRQVETPGVAY---TLMAGGCAGMSSWLACYPIDVVKTHMQA-DALGANAKYNG 266

  Fly   269 ISDCITKTLKHEGPTAFFKG 288
            ..||..|..::|||..||:|
  Fly   267 FIDCAMKGFRNEGPQYFFRG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 21/84 (25%)
Mito_carr 115..213 CDD:278578 34/99 (34%)
Mito_carr 226..307 CDD:278578 24/63 (38%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 24/89 (27%)
PTZ00169 41..295 CDD:240302 85/277 (31%)
Mito_carr 128..218 CDD:278578 35/113 (31%)
Mito_carr 221..304 CDD:278578 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.