DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG9582

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:290 Identity:86/290 - (29%)
Similarity:134/290 - (46%) Gaps:31/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGP-NGERMYNSMFDCFRKTYKAEGYF 79
            |.||      :.||::|.|.:.|..|||:||||:|.|...| .||.:|....|...|.|:.||..
  Fly    14 HWQF------LAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLS 72

  Fly    80 GMYRGSGVNILLITPEKAIKL----TANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPM 140
            .:::|....|.:.||::..|.    :...||:.....   ..|||..| :|.:|...:..:..|.
  Fly    73 SLWKGIVPPICVETPKRGGKFLMYESLKPYFQFGAPQ---PTPLTHAM-SGSMAAILESFLVNPF 133

  Fly   141 ELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDK--GIFGLYKGIGATGLRDVTFSIIY 203
            |::|| .|.|.|        ||.::.:|   :...:||..  ||.|||:||.|...|:..|...:
  Fly   134 EVVKI-TQQAHR--------GKRLKTLS---VVKYIIKHDGYGIKGLYRGITALVARNAVFHFGF 186

  Fly   204 FPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKG 268
            |..:..|.|:.|...|.:.. :.....:||||:.....::|. .|:.|.|:|..:...||.:::.
  Fly   187 FGFYNALKDIVPSPEDKTYN-ILRKVIIAGLASSLACVMSVT-LDMAKCRIQGPQPVKGEVKYQW 249

  Fly   269 ISDCITKTLKHEGPTAFFKGGLCRMIVIAP 298
            ....|..|.|.||..:.|||....::.:.|
  Fly   250 TISTIKSTFKEEGFRSLFKGLGAMILRVGP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 26/81 (32%)
Mito_carr 115..213 CDD:278578 30/99 (30%)
Mito_carr 226..307 CDD:278578 20/73 (27%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 84/287 (29%)
Mito_carr 17..104 CDD:278578 30/92 (33%)
Mito_carr 109..196 CDD:278578 30/102 (29%)
Mito_carr 216..295 CDD:278578 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.