DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and MME1

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:133/290 - (45%) Gaps:25/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 INGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGE-RMYNSMFDCFRKTYKAEGYFGMYRGSGVNI 89
            |.||:.|:..|....|||.:|.|||.....|.|: ..|..:.||..:|::.||:.|.|||....:
  Fly    19 IAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPL 83

  Fly    90 LLITPEKAIKLTANDYFRHK-LTTKDGKLPLTSQMV--AGGLAGAFQIIVTTPMELLKIQMQDAG 151
            :.:||..|:....  |...| |...|..:.||...:  ||.|||....:||.|.:.:|:.:| ..
  Fly    84 VGVTPIYAVDFAV--YAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQ-TQ 145

  Fly   152 RVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPR 216
            .|:....|...|::      .|::|.:..||..|:||..|..|||.... .||..:..|.:|. |
  Fly   146 TVSNGPLLYNGTID------TAAKLYRQGGIRSLFKGTCACILRDSPTG-FYFVTYEFLQELA-R 202

  Fly   217 RNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFK-GISDCITKTLKHE 280
            :...:|:.....:.|:|..||........||||:|:|||:..    |..:| ||.......:..|
  Fly   203 KKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAP----EGTYKHGIRSVFRNLMATE 263

  Fly   281 GPTAFFKGGLCRMI-----VIAPLFGIAQT 305
            ||.|.|:|.|..::     ..|..||:..|
  Fly   264 GPKALFRGILPILLRAFPSTAAVFFGVELT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 26/78 (33%)
Mito_carr 115..213 CDD:278578 29/99 (29%)
Mito_carr 226..307 CDD:278578 27/86 (31%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 30/89 (34%)
Mito_carr 111..205 CDD:278578 31/102 (30%)
Mito_carr 208..297 CDD:278578 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.