DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:332 Identity:90/332 - (27%)
Similarity:135/332 - (40%) Gaps:61/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSATIATPLPQP-QHQ----------QFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGP 56
            :|:|.:.|.|.. :||          .||.  ..|...:|..|.....:||||.|||||.|..|.
  Fly    13 ASSTSSNPAPSSGRHQLRPVKFDYADSFAC--TYIVSVVAASIAELATYPLDLTKTRLQIQGEGA 75

  Fly    57 -----NGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPE-------KAIKLTANDYFRHK 109
                 .....|..|........:.||...:::|       :||.       ..:::.:.|..|.:
  Fly    76 AHSAGKSNMQYRGMVATAFGIAREEGALKLWQG-------VTPALYRHVVYSGVRICSYDLMRKE 133

  Fly   110 LTTKDGK-LPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLA 173
            .|....: ||:....:.|..|||....:.:|.:|:|:|:|..||    .:|.|:.....||....
  Fly   134 FTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGR----RRLMGEPPRVHSAGHAF 194

  Fly   174 SQLIKDKGIFGLYKG-------IGATGLRDVTFSIIYFPLFATLNDLGPRRNDGSGEAVFWC--- 228
            .|:::..||.||:||       .....|.|:|       .:.|:..|...|.....     |   
  Fly   195 RQIVQRGGIKGLWKGSIPNVQRAALVNLGDLT-------TYDTIKHLIMNRLQMPD-----CHTV 247

  Fly   229 SFLAGLAAGSTAALAVNPFDVVKTRL--QAIKKADGEKEFKGISDCITKTLKHEGPTAFFKGGLC 291
            ..||.:.||..||:...|.||||||:  |...:......::|..||:.:|:..||..|.:||.|.
  Fly   248 HVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLP 312

  Fly   292 RMIVIAP 298
            ..|.:||
  Fly   313 CWIRMAP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 21/88 (24%)
Mito_carr 115..213 CDD:278578 28/105 (27%)
Mito_carr 226..307 CDD:278578 28/78 (36%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 84/306 (27%)
Mito_carr 39..138 CDD:278578 26/107 (24%)
Mito_carr 142..239 CDD:278578 29/107 (27%)
Mito_carr 248..336 CDD:278578 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.