DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and Ant2

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:124/292 - (42%) Gaps:37/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPN--GERMYNSMFDCFRKTYKAEGYFGMY 82
            :.|...:.||::..|..|.|.|::.||..||.|::...  .::.|..:.|||.:..|.:|:...:
  Fly    17 SFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFW 81

  Fly    83 RGSGVNILLITPEKAIKLTANDYF---------RHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTT 138
            ||:..|::...|.:|:.....|.:         :||...:.    ....:.:||.|||..:....
  Fly    82 RGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRH----FAGNLASGGAAGATSLCFVY 142

  Fly   139 PMELLKIQM-QDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKG--IGATGLRDVTFS 200
            |::..:.:: .|.|:        |...|.........::||..|..|||:|  :...|:  |.:.
  Fly   143 PLDFARTRLAADVGK--------GGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGI--VIYR 197

  Fly   201 IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRL---QAIKKADG 262
            ..||..:.|..|..|...    ...|:.|:.......:.|.:|..|||.|:.|:   ..:||:  
  Fly   198 AAYFGFYDTCRDFLPNPK----STPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKS-- 256

  Fly   263 EKEFKGISDCITKTLKHEGPTAFFKGGLCRMI 294
            |..:|..:.|.....|.||..|||||.|..:|
  Fly   257 EMVYKNTAHCWLVIAKQEGIGAFFKGALSNII 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 22/87 (25%)
Mito_carr 115..213 CDD:278578 22/100 (22%)
Mito_carr 226..307 CDD:278578 24/72 (33%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 74/292 (25%)
Mito_carr 17..111 CDD:278578 24/93 (26%)
Mito_carr 119..215 CDD:278578 24/109 (22%)
Mito_carr 218..307 CDD:278578 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.