DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and sesB

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:282 Identity:72/282 - (25%)
Similarity:123/282 - (43%) Gaps:33/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQ----NQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVN 88
            |||:..:..|.|.|::.||..||    ::||.|  ::.|..|.|||.:..|.:|:...:||:..|
  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQISP--DKQYKGMVDCFIRIPKEQGFSSFWRGNLAN 92

  Fly    89 ILLITPEKAIKLTANDYFRHKLTTKDGKLPLTSQ--------MVAGGLAGAFQIIVTTPMELLKI 145
            ::...|.:|:.....|.::....   |.:...:|        :.:||.|||..:....|::..:.
  Fly    93 VIRYFPTQALNFAFKDKYKQVFL---GGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFART 154

  Fly   146 QM-QDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFAT 209
            :: .|.|:        |...|........:::.|..||.|||:|.|.:....:.:...||..:.|
  Fly   155 RLAADTGK--------GGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDT 211

  Fly   210 LNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTR--LQAIKKADGEKEFKGISDC 272
            ...:.|   |.....:: .|:.......:.|.:...|||.|:.|  :|:.:||. |..:|....|
  Fly   212 ARGMLP---DPKNTPIY-ISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKAT-EVIYKNTLHC 271

  Fly   273 ITKTLKHEGPTAFFKGGLCRMI 294
            .....|.||..|||||....::
  Fly   272 WATIAKQEGTGAFFKGAFSNIL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 23/80 (29%)
Mito_carr 115..213 CDD:278578 23/106 (22%)
Mito_carr 226..307 CDD:278578 21/71 (30%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 26/90 (29%)
PTZ00169 23..312 CDD:240302 72/282 (26%)
Mito_carr 124..220 CDD:278578 23/106 (22%)
Mito_carr 223..312 CDD:278578 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.