DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG1628

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:315 Identity:78/315 - (24%)
Similarity:118/315 - (37%) Gaps:77/315 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYF-GMYRGSGVNILL 91
            |.:.|...|....|||.||.:||      .....|..|.|||..||:.:|.. |:|.||...:..
  Fly   176 GSLGGAAQVYVSQPLDTVKVKLQ------TFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFA 234

  Fly    92 ITPEKAI-----------------KLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTP 139
            ...|.::                 |.||.|     |||       .....||.||..|..:...|
  Fly   235 NVAENSVLFAAYGGCQKFVAFCVGKETAGD-----LTT-------VQNACAGSLAACFSTLTLCP 287

  Fly   140 MELLKIQMQDAGRVAAAAKLAGKTVEKV------SATQLASQLIKDKGIFGLYKGIGATGLRDVT 198
            .||:|.::|       |.:.....||..      :...|...:.:.:||.|.|:|:.:|.||::.
  Fly   288 TELIKCKLQ-------ALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMP 345

  Fly   199 FSIIYFPLF-----------ATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKT 252
            ....:|..:           .:.:|:||.|           :.:||...|.....:..|.||:|:
  Fly   346 GYFFFFGSYEGTRELLRRDDQSKDDIGPLR-----------TMIAGAIGGVCLWTSTFPADVIKS 399

  Fly   253 RLQAIKKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVY 307
            |:|.  |...|..|...:|.:    :.||..|.::|.|..::...|.......||
  Fly   400 RIQV--KNLNESMFAVGADIV----RREGVLALYRGLLPSVLRTIPATATLFVVY 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 27/94 (29%)
Mito_carr 115..213 CDD:278578 23/114 (20%)
Mito_carr 226..307 CDD:278578 19/80 (24%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 78/315 (25%)
Mito_carr 170..252 CDD:278578 23/81 (28%)
Mito_carr 263..364 CDD:278578 27/119 (23%)
Mito_carr 369..455 CDD:278578 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.