DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and CG5254

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:286 Identity:88/286 - (30%)
Similarity:140/286 - (48%) Gaps:28/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIINGGIAGIIGVTCVFPLDLVKTRLQNQQI-GPN----GERMYNSMFDCFRKTYKAEGYFGMYR 83
            :::.||.||.:.|..:.|||:||||:|.|.. .||    ||..||.:||||.|.|:.||....::
  Fly    17 QVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWK 81

  Fly    84 GSGVNILLITPEKAIKL----TANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLK 144
            |....||..||::|||.    .....|:....|   ..|||..: ||..||..:.|...|.|::|
  Fly    82 GIMPPILAETPKRAIKFLVFEQTKPLFQFGSPT---PTPLTFSL-AGLTAGTLEAIAVNPFEVVK 142

  Fly   145 IQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGI--FGLYKGIGATGLRDVTFSIIYFPLF 207
            :..|           |.:..:.:|...:|..:|:..|:  .||.|||.||..|:..|:::||..:
  Fly   143 VAQQ-----------ADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFY 196

  Fly   208 ATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDC 272
            .::.::.|...:...|  |......|..||:.|.....||||.|:|:|..:...|:.:::|....
  Fly   197 HSVKNVVPEYKESHLE--FLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQIKYRGTLSS 259

  Fly   273 ITKTLKHEGPTAFFKGGLCRMIVIAP 298
            :....:.||..|.:||.:.:::.:.|
  Fly   260 MGIVYREEGFRALYKGLVPKIMRLGP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 33/85 (39%)
Mito_carr 115..213 CDD:278578 28/99 (28%)
Mito_carr 226..307 CDD:278578 20/73 (27%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 37/93 (40%)
PTZ00169 19..301 CDD:240302 88/284 (31%)
Mito_carr 122..207 CDD:278578 26/96 (27%)
Mito_carr 209..305 CDD:278578 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.