DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and SLC25A13

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_006715894.1 Gene:SLC25A13 / 10165 HGNCID:10983 Length:686 Species:Homo sapiens


Alignment Length:289 Identity:123/289 - (42%)
Similarity:173/289 - (59%) Gaps:28/289 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQQIGPN--GERMYNSMFDCFRKTYKAEGYFGMYRGSGVNIL 90
            |.:||.:|.|.|:|:||||||:|||:...:  ||.||.:.||||:|..:.||:||:|||....:|
Human   346 GSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLL 410

  Fly    91 LITPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAA 155
            .:.||||||||.||:.|.|...|||.:||.::::|||.||..|:|.|.|:|::||::|.||.:..
Human   411 GVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITT 475

  Fly   156 AAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATL-----NDLGP 215
            ..:::            |..:::|.|.||:|||..|..|||:.||.||||.:|.:     |:.| 
Human   476 GPRVS------------ALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDG- 527

  Fly   216 RRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCITKTLKHE 280
            :.:.||       ..|||..||..||..|.|.||:|||||...:| |:..:.|:.||..|.|:.|
Human   528 QVSPGS-------LLLAGAIAGMPAASLVTPADVIKTRLQVAARA-GQTTYSGVIDCFRKILREE 584

  Fly   281 GPTAFFKGGLCRMIVIAPLFGIAQTVYYL 309
            ||.|.:||...|:...:|.||:....|.|
Human   585 GPKALWKGAGARVFRSSPQFGVTLLTYEL 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 41/78 (53%)
Mito_carr 115..213 CDD:278578 38/102 (37%)
Mito_carr 226..307 CDD:278578 33/80 (41%)
SLC25A13XP_006715894.1 EF-hand_7 28..92 CDD:290234
EFh 30..92 CDD:298682
PTZ00168 338..601 CDD:185494 118/275 (43%)
Mito_carr 340..433 CDD:278578 45/86 (52%)
Mito_carr 435..522 CDD:278578 37/98 (38%)
Mito_carr 527..622 CDD:278578 38/96 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4126
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.