DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GC1 and slc25a22

DIOPT Version :9

Sequence 1:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002937547.2 Gene:slc25a22 / 100488953 XenbaseID:XB-GENE-22063017 Length:317 Species:Xenopus tropicalis


Alignment Length:314 Identity:185/314 - (58%)
Similarity:231/314 - (73%) Gaps:18/314 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGM 81
            :|.:|..|:|||||||:||||||||:||.||||||||   ||:|||.||.||..||.::||||||
 Frog     4 KQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQ---NGQRMYTSMSDCLIKTIRSEGYFGM 65

  Fly    82 YRGSGVNILLITPEKAIKLTANDYFRHKLTTKDG-KLPLTSQMVAGGLAGAFQIIVTTPMELLKI 145
            |||:.||:.|:||||||||.|||:|||.| :||| ||.|..:|:||..||..|:|||||||:|||
 Frog    66 YRGAAVNLTLVTPEKAIKLAANDFFRHAL-SKDGKKLTLLKEMLAGCGAGTCQVIVTTPMEMLKI 129

  Fly   146 QMQDAGRVAAAAKL-----------AGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTF 199
            |:|||||:||..||           |.....:.:|.|::.:|::..||.|||||:|||.||||.|
 Frog   130 QLQDAGRLAAQRKLLASQAGPNSAVAESITARPTAMQISRELLRSDGIAGLYKGLGATLLRDVPF 194

  Fly   200 SIIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEK 264
            |||||||||.||.||.:..|  |::.|:.|||:|.|||.|||:||||.||:|||||::::...|.
 Frog   195 SIIYFPLFANLNKLGQKTPD--GKSPFYVSFLSGCAAGCTAAVAVNPCDVIKTRLQSLQRGINED 257

  Fly   265 EFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVYYLGVAEGLLGY 318
            .:.||.||..|..:.|||.||.||..||.:||||||||||.:|::|:.|.|||:
 Frog   258 TYSGIIDCTRKIWRSEGPAAFLKGAYCRALVIAPLFGIAQVIYFIGIGEFLLGF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 54/76 (71%)
Mito_carr 115..213 CDD:278578 60/109 (55%)
Mito_carr 226..307 CDD:278578 47/80 (59%)
slc25a22XP_002937547.2 Mito_carr 6..96 CDD:365909 65/93 (70%)
Mito_carr 101..208 CDD:365909 58/106 (55%)
Mito_carr 218..300 CDD:365909 47/81 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H69383
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D458796at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.