DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurA and AUR2

DIOPT Version :9

Sequence 1:NP_476749.1 Gene:aurA / 41446 FlyBaseID:FBgn0000147 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001325078.1 Gene:AUR2 / 817129 AraportID:AT2G25880 Length:349 Species:Arabidopsis thaliana


Alignment Length:293 Identity:163/293 - (55%)
Similarity:211/293 - (72%) Gaps:11/293 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SKELGAASSSAEKEKTKTETQ----PQKPKKTWELNNFDIGRLLGRGKFGNVYLAREKESQFVVA 181
            |:.||  ||:.......||||    .:..:|.|..::||||:.|||||||:|||||||.|..:||
plant    51 SRYLG--SSTISSMGISTETQQIAASEAAQKRWTTSDFDIGKPLGRGKFGHVYLAREKRSDHIVA 113

  Fly   182 LKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQ 246
            ||||||.|:.:|.||||:|||:|||||||||:|||||.||:|..|:|||||||.:|.|:..|  |
plant   114 LKVLFKAQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAVRGELYKEL--Q 176

  Fly   247 PMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMT 311
            ..|.|.||::|||:.:|..||:|.|.:.:|||||||||||:|.:|.|||||||||||..| .|.|
plant   177 KCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFN-RRRT 240

  Fly   312 LCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEH-- 374
            :|||:||||||||:...|..:||:||||:||:|.|.|..||.::.:.||||:|::||.|.|..  
plant   241 MCGTLDYLPPEMVESVEHDASVDIWSLGILCYEFLYGVPPFEAREHSETYKRIVQVDLKFPPKPI 305

  Fly   375 ISKAASHLISKLLVLNPQHRLPLDQVMVHPWIL 407
            :|.:|..|||::||.....||.|.:::.||||:
plant   306 VSSSAKDLISQMLVKESTQRLALHKLLEHPWIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurANP_476749.1 STKc_Aurora 153..407 CDD:270909 151/255 (59%)
S_TKc 154..406 CDD:214567 150/253 (59%)
AUR2NP_001325078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 305 1.000 Domainoid score I325
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2670
Inparanoid 1 1.050 321 1.000 Inparanoid score I705
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D954262at2759
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 1 1.000 - - otm3008
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.