DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurA and AURKC

DIOPT Version :9

Sequence 1:NP_476749.1 Gene:aurA / 41446 FlyBaseID:FBgn0000147 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001015878.1 Gene:AURKC / 6795 HGNCID:11391 Length:309 Species:Homo sapiens


Alignment Length:299 Identity:166/299 - (55%)
Similarity:222/299 - (74%) Gaps:5/299 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ASSESSKELGAASSSAEKEKTKTET--QPQKP-KKTWELNNFDIGRLLGRGKFGNVYLAREKESQ 177
            :|..:..:||.|..:.|:..|..:|  ||..| .:...:::|:|||.||:||||||||||.|||.
Human     2 SSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESH 66

  Fly   178 FVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNA 242
            |:||||||||.||.:..:|||:|||||||:||:||:|||||.||||..|:||||||||:|.|:..
Human    67 FIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKE 131

  Fly   243 LQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNS 307
            ||..  ::.||:::||.|:.|..||.|.|::.:|||||||||||||.:|.:||||||||||.|:.
Human   132 LQKS--EKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSL 194

  Fly   308 MRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLP 372
            .|.|:|||:|||||||::|:.:.:.||||.:||||:|||||:.||.|.::.|||::|||||.:.|
Human   195 RRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFP 259

  Fly   373 EHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHTQ 411
            ..:...|..|||:||...|..||||.|::.|||:.||::
Human   260 LSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurANP_476749.1 STKc_Aurora 153..407 CDD:270909 154/253 (61%)
S_TKc 154..406 CDD:214567 153/251 (61%)
AURKCNP_001015878.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 9/30 (30%)
STKc_Aurora-B_like 36..305 CDD:271019 156/265 (59%)
S_TKc 43..293 CDD:214567 153/251 (61%)
Interaction with BIRC5. /evidence=ECO:0000269|PubMed:27332895 292..309 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 336 1.000 Domainoid score I1120
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 363 1.000 Inparanoid score I2178
Isobase 1 0.950 - 0 Normalized mean entropy S591
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 1 1.000 - - otm40694
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.950

Return to query results.
Submit another query.