DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurA and aurB

DIOPT Version :9

Sequence 1:NP_476749.1 Gene:aurA / 41446 FlyBaseID:FBgn0000147 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster


Alignment Length:288 Identity:139/288 - (48%)
Similarity:182/288 - (63%) Gaps:16/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KTETQPQKPKKT----------------WELNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVL 185
            |...:.|:|.|.                |...:|::|..|||||||.||||||:.|.::||:||:
  Fly    20 KVPEEHQEPIKNMCLKMMSHDAYGQPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVM 84

  Fly   186 FKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKR 250
            ||.::.:..|:.||.|||||||.|:|||||||..:|||:.||||.||.|.:|.||..|:..|..|
  Fly    85 FKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHR 149

  Fly   251 FDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGT 315
            |||.:||.|...:.:||.|.|..::||||:||||:||.....||:||||||.|.||:.|.|||||
  Fly   150 FDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGT 214

  Fly   316 VDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAAS 380
            :||||||||.|..:..:||.|.||:||:|.:||..||.|.:.:.||.||.:::...|.|:||...
  Fly   215 LDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCK 279

  Fly   381 HLISKLLVLNPQHRLPLDQVMVHPWILA 408
            .||..||....:.|:.|..||.|.|:.|
  Fly   280 ELIGGLLRKESKGRITLVDVMTHYWVKA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurANP_476749.1 STKc_Aurora 153..407 CDD:270909 133/253 (53%)
S_TKc 154..406 CDD:214567 132/251 (53%)
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 133/253 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 249 1.000 Domainoid score I347
eggNOG 1 0.900 - - E1_KOG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53505
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 1 1.000 - - otm46627
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - P PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
1110.860

Return to query results.
Submit another query.