DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurA and Aurkb

DIOPT Version :9

Sequence 1:NP_476749.1 Gene:aurA / 41446 FlyBaseID:FBgn0000147 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_446201.1 Gene:Aurkb / 114592 RGDID:621625 Length:343 Species:Rattus norvegicus


Alignment Length:313 Identity:166/313 - (53%)
Similarity:230/313 - (73%) Gaps:8/313 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PESLSKQKPTAASSESSKELGAASSSA------EKEKTKTETQPQKPKKTWELNNFDIGRLLGRG 163
            |:.:.:::|....:::......:.|:|      .:.|..|..|..:.::.:.::||:|||.||:|
  Rat    25 PQRVLRKEPAVTPAQALMNRSNSQSTAVPGQKLTENKGATALQGSQSRQPFTIDNFEIGRPLGKG 89

  Fly   164 KFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIY 228
            |||||||||||:|:|:||||:|||.||.:..||||:|||||||:||:||:||:||.||:|..|||
  Rat    90 KFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIY 154

  Fly   229 LILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVL 293
            |||||||:|.|:..||..  ..|||:::||.::.|..||:|.|::.:|||||||||||||.:|.|
  Rat   155 LILEYAPRGELYKELQKS--GTFDEQRTATIMEELSDALMYCHKKKVIHRDIKPENLLLGLQGEL 217

  Fly   294 KIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYD 358
            ||||||||||.|:..|.|:|||:|||||||::|:.|.:.||||.:||||:||:||:.||.|.::.
  Rat   218 KIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHS 282

  Fly   359 ETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHTQ 411
            |||::|:|||.|.|..:...|..||||||..||..||||:||..|||:.|:::
  Rat   283 ETYRRIVKVDLKFPSSMPLGAKDLISKLLKHNPSQRLPLEQVSAHPWVRANSR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurANP_476749.1 STKc_Aurora 153..407 CDD:270909 158/253 (62%)
S_TKc 154..406 CDD:214567 156/251 (62%)
AurkbNP_446201.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57 2/20 (10%)
STKc_Aurora-B_like 75..342 CDD:271019 159/263 (60%)
S_TKc 80..330 CDD:214567 156/251 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 331 1.000 Domainoid score I1109
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 362 1.000 Inparanoid score I2120
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 1 1.000 - - otm44830
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.