Sequence 1: | NP_650132.1 | Gene: | CG3281 / 41445 | FlyBaseID: | FBgn0260741 | Length: | 538 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_085034.2 | Gene: | Mynn / 80732 | MGIID: | 1931415 | Length: | 610 | Species: | Mus musculus |
Alignment Length: | 325 | Identity: | 99/325 - (30%) |
---|---|---|---|
Similarity: | 148/325 - (45%) | Gaps: | 69/325 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 PDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRH------------------FS 223
Fly 224 QAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARK 288
Fly 289 RIAKRRDCPHCGLSFPVSS-LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECK 352
Fly 353 ICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCG 417
Fly 418 SHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSEDIERMRLQRIPENQLQQRLENLP 482
Fly 483 482 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3281 | NP_650132.1 | zf-AD | 14..92 | CDD:285071 | |
C2H2 Zn finger | 205..226 | CDD:275368 | 10/38 (26%) | ||
C2H2 Zn finger | 249..266 | CDD:275368 | 5/16 (31%) | ||
COG5048 | <294..>391 | CDD:227381 | 44/97 (45%) | ||
C2H2 Zn finger | 296..315 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 307..330 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 323..343 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 335..358 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 351..371 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 364..388 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 379..399 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 391..416 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 407..424 | CDD:275368 | 5/16 (31%) | ||
Mynn | NP_085034.2 | BTB | 14..115 | CDD:279045 | |
BTB | 25..118 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 156..199 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 174..190 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 257..262 | ||||
C2H2 Zn finger | 304..324 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 304..324 | CDD:278523 | 8/19 (42%) | ||
zf-H2C2_2 | 316..341 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 332..352 | CDD:275368 | 4/25 (16%) | ||
zf-H2C2_2 | 345..369 | CDD:290200 | 7/29 (24%) | ||
C2H2 Zn finger | 360..380 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 401..426 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 417..437 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 430..453 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 445..465 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 457..482 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 473..493 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 501..522 | CDD:275368 | 8/26 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 519..548 | 7/38 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |