DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Mynn

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_085034.2 Gene:Mynn / 80732 MGIID:1931415 Length:610 Species:Mus musculus


Alignment Length:325 Identity:99/325 - (30%)
Similarity:148/325 - (45%) Gaps:69/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRH------------------FS 223
            |.|:||    ...:|.:|.:.:...   |..|.:||:::.||.||                  |:
Mouse   283 PYELEN----AGEELDARFSKAKPM---CNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFT 340

  Fly   224 QAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARK 288
            |.::|...|      ....|.....||.|.:.|.::..|..|.:..|.:                
Mouse   341 QCNQLKTHV------RTHTGERPYKCELCDKGFAQKCQLVFHSRMHHGE---------------- 383

  Fly   289 RIAKRRDCPHCGLSFPVSS-LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECK 352
              .|...|..|.|.|..|| |.||.|:|:|:.||.||:|.:.|.::..|:.|:|:||||:|..|.
Mouse   384 --EKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCD 446

  Fly   353 ICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCG 417
            .|.|.|...:.|..|.|.|||::||.|.:|.|||:.|.:|..|.|.||||||:.|.:||.|:.  
Mouse   447 TCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYT-- 509

  Fly   418 SHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSEDIERMRLQRIPENQLQQRLENLP 482
               :| :|.|.|...|..|.:...:.:.|.:.   |:::.|       :||.|   |.:.|:..|
Mouse   510 ---DI-KNLKKHKTKVHSGTDKNPDCSVDDHA---VSEQDS-------VQRSP---LSETLDVKP 557

  Fly   483  482
            Mouse   558  557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 10/38 (26%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 44/97 (45%)
C2H2 Zn finger 296..315 CDD:275368 10/19 (53%)
zf-H2C2_2 307..330 CDD:290200 12/23 (52%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 13/23 (57%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..424 CDD:275368 5/16 (31%)
MynnNP_085034.2 BTB 14..115 CDD:279045
BTB 25..118 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..199
Nuclear localization signal. /evidence=ECO:0000255 174..190
Nuclear localization signal. /evidence=ECO:0000255 257..262
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
zf-C2H2 304..324 CDD:278523 8/19 (42%)
zf-H2C2_2 316..341 CDD:290200 5/24 (21%)
C2H2 Zn finger 332..352 CDD:275368 4/25 (16%)
zf-H2C2_2 345..369 CDD:290200 7/29 (24%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 389..409 CDD:275368 10/19 (53%)
zf-H2C2_2 401..426 CDD:290200 12/24 (50%)
C2H2 Zn finger 417..437 CDD:275368 7/19 (37%)
zf-H2C2_2 430..453 CDD:290200 11/22 (50%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
zf-H2C2_2 457..482 CDD:290200 13/24 (54%)
C2H2 Zn finger 473..493 CDD:275368 9/19 (47%)
C2H2 Zn finger 501..522 CDD:275368 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..548 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.