DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Zfp266

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001075954.1 Gene:Zfp266 / 77519 MGIID:1924769 Length:604 Species:Mus musculus


Alignment Length:324 Identity:94/324 - (29%)
Similarity:141/324 - (43%) Gaps:60/324 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 MAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEPEDSFQLKPRPDEIENREL 185
            :.||:|       :..|||  .:.|.............::..:....|..|..|......:|.  
Mouse   330 LTQYVS-------IHTEEK--SKVCKICGKSFANYSRLSAHVKTHNEEKPFVCKECGKAFKNM-- 383

  Fly   186 SRPSQLGSRLN-HSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTC 249
               |.|...:. |:....|||..|.:.|.:...||.|. :.|               .|.....|
Mouse   384 ---SYLNDHVRIHTGIKSYKCMECGKAFLRWSGLTEHI-RVH---------------TGEKPYEC 429

  Fly   250 EHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIR 313
            :.|.:||.|...|..|::..    ..::|.|               |..||.:| ..|.|..|:|
Mouse   430 KECGKTFSRSTQLTEHIRTH----TGIKPYE---------------CKECGKAFTQYSGLATHVR 475

  Fly   314 RHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYS 378
            .|:|:.|:.|.:|.|||.|:..|..|:|.||||:|.||..|.|.||:.:...:|:::|:|::|:.
Mouse   476 IHSGEKPFACKECGKAFTRTSGLIHHVRTHTGEKPFECVHCGKTFITSSHRTKHLKIHSGEKPFV 540

  Fly   379 CKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGS----HLNIHRNRK-----GHLIAV 433
            |.:|.|:|:.|..|.||||.||||:||.|..||::|...|    |..:|...|     |..:|:
Mouse   541 CNICGKAFIYSTSLNIHMRTHTGEKPYICKQCGKAFAVYSRLRKHSRVHTEEKPYQCEGMAVAI 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..266 CDD:275368 6/16 (38%)
COG5048 <294..>391 CDD:227381 40/97 (41%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 8/23 (35%)
C2H2 Zn finger 379..399 CDD:275368 10/19 (53%)
zf-H2C2_2 391..416 CDD:290200 15/24 (63%)
C2H2 Zn finger 407..424 CDD:275368 6/20 (30%)
Zfp266NP_001075954.1 KRAB 41..97 CDD:214630
C2H2 Zn finger 265..281 CDD:275368
C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 317..337 CDD:275368 3/13 (23%)
C2H2 Zn finger 345..365 CDD:275368 1/19 (5%)
zf-H2C2_2 357..382 CDD:372612 3/24 (13%)
C2H2 Zn finger 373..393 CDD:275368 4/24 (17%)
COG5048 <397..588 CDD:227381 76/225 (34%)
C2H2 Zn finger 401..421 CDD:275368 6/20 (30%)
C2H2 Zn finger 429..449 CDD:275368 7/19 (37%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
C2H2 Zn finger 485..505 CDD:275368 9/19 (47%)
C2H2 Zn finger 513..533 CDD:275368 6/19 (32%)
C2H2 Zn finger 541..561 CDD:275368 10/19 (53%)
C2H2 Zn finger 569..589 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.