DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZNF177

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001166122.1 Gene:ZNF177 / 7730 HGNCID:12966 Length:481 Species:Homo sapiens


Alignment Length:459 Identity:120/459 - (26%)
Similarity:174/459 - (37%) Gaps:130/459 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GDQDC-SAFTSDVGEEPLYASED---RDDEPEDSFQLKPRPDEIE-------------NRELSRP 188
            |.|.| .:..|.|.:|.|...|.   :.|..:...||||: |.|.             |...::|
Human    54 GYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPK-DTIAMQNIPGGKTSNGINTAENQP 117

  Fly   189 SQLGSRLNHSANFIYKCA-VCPRVFAKSESLTRH------FSQAHKLTADVAAMKLANESCGTGL 246
            .:.....||...|..... :|.| :.|.|...::      |:....|.:.|:.      ..|...
Human   118 GEHSLECNHCGKFRKNTRFICTR-YCKGEKCYKYIKYSKVFNHPSTLRSHVSI------HIGEKT 175

  Fly   247 LTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDN--------SARKRIAKRR--------- 294
            |....|.:.|.::.:||:|::.  |.....:..|..|.        |.|::|....         
Human   176 LEFTDCRKAFNQESSLRKHLRT--PTGQKFQEYEQCDMSFSLHSSCSVREQIPTGEKGDECSDYG 238

  Fly   295 ----------------------------------------------DCPHCGLSFPV-SSLTIHI 312
                                                          :|..||.:|.. |||..|:
Human   239 KISPLSVHTKTGSVEEGLECNEHEKTFTDPLSLQNCVRTHSGEMPYECSDCGKAFIFQSSLKKHM 303

  Fly   313 RRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPY 377
            |.|||:.||:||.|.|:|.:|..|::|.|.||||:|.:||.|.|.|...:.|.:|:|.|||::||
Human   304 RSHTGEKPYECDHCGKSFSQSSHLNVHKRTHTGEKPYDCKECGKAFTVPSSLQKHVRTHTGEKPY 368

  Fly   378 SCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH-RNRKGHLIAVIPGNEVEA 441
            .|..|.|:|:..:.||.|.|.||||:||:|..||:||..||:|.:| |...|.  ......|...
Human   369 ECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSYLIVHKRTHTGE--KTYECKECGK 431

  Fly   442 NFAADPYVNARVNQRRSEDIERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALL 506
            .|.....:...|.....|                       ||      |||..||:.|.:...|
Human   432 AFRNSSCLRVHVRTHTGE-----------------------KP------YKCIQCEKAFSTSTNL 467

  Fly   507 TVHR 510
            .:|:
Human   468 IMHK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 5/27 (19%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 45/152 (30%)
C2H2 Zn finger 296..315 CDD:275368 9/19 (47%)
zf-H2C2_2 307..330 CDD:290200 13/22 (59%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 364..388 CDD:290200 12/23 (52%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 15/24 (63%)
C2H2 Zn finger 407..424 CDD:275368 9/17 (53%)
ZNF177NP_001166122.1 KRAB 14..70 CDD:214630 5/15 (33%)
C2H2 Zn finger 124..142 CDD:275368 5/18 (28%)
C2H2 Zn finger 150..170 CDD:275368 3/25 (12%)
C2H2 Zn finger 178..197 CDD:275368 5/18 (28%)
COG5048 <212..442 CDD:227381 71/231 (31%)
C2H2 Zn finger 258..278 CDD:275368 0/19 (0%)
C2H2 Zn finger 286..306 CDD:275368 9/19 (47%)
C2H2 Zn finger 314..334 CDD:275368 9/19 (47%)
C2H2 Zn finger 342..362 CDD:275368 8/19 (42%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..446 CDD:275368 3/19 (16%)
zf-H2C2_2 439..463 CDD:404364 10/52 (19%)
C2H2 Zn finger 454..474 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.