DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZNF131

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001284477.1 Gene:ZNF131 / 7690 HGNCID:12915 Length:623 Species:Homo sapiens


Alignment Length:406 Identity:96/406 - (23%)
Similarity:176/406 - (43%) Gaps:62/406 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ISSQTCRVCLE-THETNLYVHDEIKYNDL--KLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARR 71
            :|....|..:| |:...|.:..|.:.||:  ..|..|:|||:..|:....:.:.|:.  :|...:
Human    77 VSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLE--ENTTGK 139

  Fly    72 LIGAYEFIVEVENA-HETLQNLFEQQEVAAKPDEVHVDVVE---LIDQDDVVSMAQYLSTSFAEQ 132
            .......|.|..|. .|:|.:      ..::|.|:.|::.|   .::.:.:.::.:..|   |:|
Human   140 NEAKKRKIAETSNVITESLPS------AESEPVEIEVEIAEGTIEVEDEGIETLEEVAS---AKQ 195

  Fly   133 HVEMEEKYGDQDCSAFT--SDVGEEPLYASEDRDDE-PEDSFQLKPRPDEIENRELSRPSQLGSR 194
            .|:..:..|..|.||..  :|:..:  |...||..: .||.....|...::|..|:     :..:
Human   196 SVKYIQSTGSSDDSALALLADITSK--YRQGDRKGQIKEDGCPSDPTSKQVEGIEI-----VELQ 253

  Fly   195 LNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQ 259
            |:|..: ::.|..|.|.|    .|..||.:..|             |..|....||.|.:.:.|:
Human   254 LSHVKD-LFHCEKCNRSF----KLFYHFKEHMK-------------SHSTESFKCEICNKRYLRE 300

  Fly   260 DTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFP-VSSLTIHIRRHTGDNPYKC 323
            ...::|:..:|.:...:..::.|..       |...|.:|...|. ......|:|:|||:.|::|
Human   301 SAWKQHLNCYHLEEGGVSKKQRTGK-------KIHVCQYCEKQFDHFGHFKEHLRKHTGEKPFEC 358

  Fly   324 DQCEKAFPRSQDLSLHMRQ-HTG-------ERPSECKICSKKFISQNKLARHMRLHTGQRPYSCK 380
            ..|.:.|.|:..|..|:.. .||       ::..||::|:..|.|.::...|:.:|||.:|..|.
Human   359 PNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPNHCT 423

  Fly   381 MCSKSFVQSNDLKIHM 396
            :|...|:|.|:|:.|:
Human   424 LCDLWFMQGNELRRHL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 20/81 (25%)
C2H2 Zn finger 205..226 CDD:275368 7/20 (35%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 31/105 (30%)
C2H2 Zn finger 296..315 CDD:275368 5/19 (26%)
zf-H2C2_2 307..330 CDD:290200 8/22 (36%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 335..358 CDD:290200 7/30 (23%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 8/23 (35%)
C2H2 Zn finger 379..399 CDD:275368 7/18 (39%)
zf-H2C2_2 391..416 CDD:290200 2/6 (33%)
C2H2 Zn finger 407..424 CDD:275368
ZNF131NP_001284477.1 BTB 24..122 CDD:279045 13/44 (30%)
BTB 35..122 CDD:197585 13/44 (30%)
Nuclear localization signal 1. /evidence=ECO:0000269|PubMed:17306895 137..148 0/10 (0%)
COG5048 <262..444 CDD:227381 52/202 (26%)
C2H2 Zn finger 263..283 CDD:275368 8/36 (22%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
Nuclear localization signal 2. /evidence=ECO:0000269|PubMed:17306895 317..328 2/17 (12%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
zf-H2C2_2 342..367 CDD:290200 9/24 (38%)
C2H2 Zn finger 358..375 CDD:275368 5/16 (31%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
C2H2 Zn finger 422..439 CDD:275370 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 573..623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.