DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZSCAN21

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001349708.1 Gene:ZSCAN21 / 7589 HGNCID:13104 Length:473 Species:Homo sapiens


Alignment Length:472 Identity:124/472 - (26%)
Similarity:182/472 - (38%) Gaps:112/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTPEIHVNISSQTCRVCLETHETNLYVHDEIKYNDLKLELW---QLLEAVSKLKWTWTDPNLPMH 63
            |||.....: ||...:|.|      ::..||...:..|||.   |.|..:.:....|...:.|. 
Human    55 DTPGPREAL-SQLRVLCCE------WLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPE- 111

  Fly    64 LCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLSTS 128
                      .|.|.:..:|:....|..  ...:|:..|:| ...|.|.|...   ..|:...:|
Human   112 ----------SAEEAVTLLEDLERELDE--PGHQVSTPPNE-QKPVWEKISSS---GTAKESPSS 160

  Fly   129 FAEQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRD----------------------------- 164
            ...|.:|...|| :.....:..:.|||..:|.:.|.                             
Human   161 MQPQPLETSHKY-ESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI 224

  Fly   165 ------DEPEDSFQLKPRPDEIENRELSRP--SQLGSRLNHSA--------NFIYKCAVCPRVFA 213
                  ::||.|  |:.:...:||.:.::|  .:.||:....:        ...|.||.|.:.|:
Human   225 ISVIIANKPEAS--LERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAECGKAFS 287

  Fly   214 KSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEP 278
            .|.:||:| .:.|               .|.....|..|.:.|.....|..|.:....|      
Human   288 NSSNLTKH-RRTH---------------TGEKPYVCTKCGKAFSHSSNLTLHYRTHLVD------ 330

  Fly   279 EETTDNSARKRIAKRRDCPHCGLSFPVSS-LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQ 342
                         :..|| .||.:|..|| |..|.|.||.:.||:|..|.|||.....|..|.|.
Human   331 -------------RPYDC-KCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRI 381

  Fly   343 HTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQC 407
            ||||:|.:|..|.|.|.....|:.|.|||||::||.||.|.|:|..|::...|.|.||||:||.|
Human   382 HTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWC 446

  Fly   408 GVCGESFVCGSHLNIHR 424
            ..||::|...|:|:.|:
Human   447 HHCGKTFCSKSNLSKHQ 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 15/80 (19%)
C2H2 Zn finger 205..226 CDD:275368 8/20 (40%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 46/97 (47%)
C2H2 Zn finger 296..315 CDD:275368 9/19 (47%)
zf-H2C2_2 307..330 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 14/23 (61%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 12/24 (50%)
C2H2 Zn finger 407..424 CDD:275368 6/16 (38%)
ZSCAN21NP_001349708.1 SCAN 42..153 CDD:128708 26/121 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..169 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..272 5/27 (19%)
COG5048 <276..453 CDD:227381 74/212 (35%)
C2H2 Zn finger 279..299 CDD:275368 8/20 (40%)
C2H2 Zn finger 307..327 CDD:275368 5/19 (26%)
C2H2 Zn finger 337..354 CDD:275368 8/16 (50%)
C2H2 Zn finger 362..382 CDD:275368 8/19 (42%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 418..438 CDD:275368 8/19 (42%)
C2H2 Zn finger 446..466 CDD:275368 7/18 (39%)
zf-C2H2 446..466 CDD:395048 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.