DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZNF10

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_056209.2 Gene:ZNF10 / 7556 HGNCID:12879 Length:573 Species:Homo sapiens


Alignment Length:612 Identity:137/612 - (22%)
Similarity:209/612 - (34%) Gaps:220/612 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EIHVNISS-------QTCRVCLETHETNLYVHDEIKYNDLKLELWQLLEAVSKLKWTWTDPNLPM 62
            ||..::||       |:|.:.:|....|     ::.|..|: |:|:..:.:.|.:     .|...
Human    92 EIKSSVSSRSIFKDKQSCDIKMEGMARN-----DLWYLSLE-EVWKCRDQLDKYQ-----ENPER 145

  Fly    63 HLCQNCARRLIGAYEFIVEVENAHET--------------LQNLFEQQEVAAKPDEVHVDVVELI 113
            ||     |::....:.::..|...|:              |:..|.:::...|  .:..|:|...
Human   146 HL-----RQVAFTQKKVLTQERVSESGKYGGNCLLPAQLVLREYFHKRDSHTK--SLKHDLVLNG 203

  Fly   114 DQDDVVSMAQYLSTS---------FAEQH--------------------------VEMEEKYGDQ 143
            .||...|.:.....:         ||..|                          :..|:.|..:
Human   204 HQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLTHGSSLGISKGIHREKPYECK 268

  Fly   144 DCSAFTS-----------DVGEEPLYASEDRDDEPEDSFQLKPRPDEIENRELSRPSQL-GSRLN 196
            :|..|.|           ..||:|....|.                   .:..||.|.| |.:..
Human   269 ECGKFFSWRSNLTRHQLIHTGEKPYECKEC-------------------GKSFSRSSHLIGHQKT 314

  Fly   197 HSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDT 261
            |:....|:|..|.:.|:....|..| .:.|               .|..|.||..|.::|.....
Human   315 HTGEEPYECKECGKSFSWFSHLVTH-QRTH---------------TGDKLYTCNQCGKSFVHSSR 363

  Fly   262 LRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFPVSS-LTIHIRRHTGDNPYKCDQ 325
            |.||.:....:                   |..:||.||.||..|: |.:|.|.|....||:|::
Human   364 LIRHQRTHTGE-------------------KPYECPECGKSFRQSTHLILHQRTHVRVRPYECNE 409

  Fly   326 CEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSN 390
            |.|::.:...|.:|.|.|||.:|.|||.|.|.|...:.|..|.|.|||::||.|..|.|||.||:
Human   410 CGKSYSQRSHLVVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSS 474

  Fly   391 DLKIHMRRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQ 455
            .|.:|.|.||||:||:|..||::|:          ||..||                        
Human   475 ALIVHQRIHTGEKPYECCQCGKAFI----------RKNDLI------------------------ 505

  Fly   456 RRSEDIERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALLTVHR---------- 510
                     :.|||               .|....|||..|...|...:...||:          
Human   506 ---------KHQRI---------------HVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLT 546

  Fly   511 -----------NKMSHYEIERVYENPF 526
                       :.:..|:...:.||.:
Human   547 CNQCGTALVNTSNLIGYQTNHIRENAY 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 15/91 (16%)
C2H2 Zn finger 205..226 CDD:275368 5/20 (25%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 44/97 (45%)
C2H2 Zn finger 296..315 CDD:275368 10/19 (53%)
zf-H2C2_2 307..330 CDD:290200 9/23 (39%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
zf-H2C2_2 335..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 364..388 CDD:290200 13/23 (57%)
C2H2 Zn finger 379..399 CDD:275368 10/19 (53%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..424 CDD:275368 4/16 (25%)
ZNF10NP_056209.2 KRAB 14..73 CDD:214630
C2H2 Zn finger 213..232 CDD:275368 2/18 (11%)
C2H2 Zn finger 267..287 CDD:275368 3/19 (16%)
COG5048 <272..474 CDD:227381 72/255 (28%)
C2H2 Zn finger 295..315 CDD:275368 6/38 (16%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 10/19 (53%)
C2H2 Zn finger 407..427 CDD:275368 6/19 (32%)
C2H2 Zn finger 435..455 CDD:275368 8/19 (42%)
C2H2 Zn finger 463..483 CDD:275368 10/19 (53%)
C2H2 Zn finger 491..511 CDD:275368 11/77 (14%)
C2H2 Zn finger 519..539 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.