DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Zbtb7c

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001120847.1 Gene:Zbtb7c / 679155 RGDID:1591841 Length:619 Species:Rattus norvegicus


Alignment Length:508 Identity:118/508 - (23%)
Similarity:173/508 - (34%) Gaps:179/508 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLSTSFAE------QHVEMEEKYGDQDCSAF 148
            :.||....:|::|   :|..::.:..:.:.::.::..||...      :|:....:..:..|...
  Rat    60 KKLFTAGNLASQP---YVYEIDFVQPEALAAILEFAYTSTLTITASNVKHILNAARMLEIQCIVN 121

  Fly   149 T--------SDVGEEPLYASEDRDDEPEDSFQLKPRPDEIENRE-----------LSRPSQLGSR 194
            .        .:||||.....||.|::.:|....:...:|.|..|           |..|..:.  
  Rat   122 VCLEIMEPGGNVGEEDDKEEEDDDEDDDDEDDEEEEEEEEEEEEDDTEDFADQENLPDPQDIN-- 184

  Fly   195 LNHSANFIYKCAVCPRVFAKSESLT-RHFSQAHKLTADVAAMKLANESCG-TGLLTCEHCPRTFK 257
                         ||:..:|::.|| :.:|...:...|    ....||.| .|::      |.|.
  Rat   185 -------------CPQSPSKTDCLTEKDYSDTPRDFPD----SFQPESPGHLGVI------RDFS 226

  Fly   258 RQDTLRRHM--QAFHPD----------------------AIALEPEETTDNSARKRIAKRR---- 294
            .:..||.::  :|..||                      |.|..||:..|:.....:.|.|    
  Rat   227 IESLLRENLYPKASIPDRRPSLSPFAPEFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKDRKIKE 291

  Fly   295 ------------------------DCP-----------------------HCGLSFPVSSLTIHI 312
                                    |.|                       |.|..||...| :..
  Rat   292 EEKEELAPPPPPPFSSDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGSLFPPWPL-VEE 355

  Fly   313 RRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPY 377
            |:.......:|..|.|....:..|..|||.||||:|..|.||..:|..|:||..|||.|||:|||
  Rat   356 RKLKPKASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCSICEVRFTRQDKLKIHMRKHTGERPY 420

  Fly   378 SCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH------------RNRK--- 427
            .|..|:..||.:.|||.|||.|||.|||||..|.:||....||:.|            |.||   
  Rat   421 LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRGRKPAA 485

  Fly   428 ------------------------------GHL---IAVIPGNEVEANFAADP 447
                                          |||   ...:||.....:|.|.|
  Rat   486 WRAASLLFGPGGPSADKAAFVMPPALGDVGGHLGGTAVCLPGPSPAKHFLASP 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 0/1 (0%)
C2H2 Zn finger 205..226 CDD:275368 6/21 (29%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 41/147 (28%)
C2H2 Zn finger 296..315 CDD:275368 7/41 (17%)
zf-H2C2_2 307..330 CDD:290200 5/22 (23%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 10/19 (53%)
zf-H2C2_2 364..388 CDD:290200 13/23 (57%)
C2H2 Zn finger 379..399 CDD:275368 10/19 (53%)
zf-H2C2_2 391..416 CDD:290200 17/24 (71%)
C2H2 Zn finger 407..424 CDD:275368 7/28 (25%)
Zbtb7cNP_001120847.1 BTB_POZ_ZBTB7C_ZBTB36 9..128 CDD:349637 9/70 (13%)
C2H2 Zn finger 366..386 CDD:275368 7/19 (37%)
SFP1 <380..468 CDD:227516 48/87 (55%)
C2H2 Zn finger 394..414 CDD:275368 10/19 (53%)
C2H2 Zn finger 422..442 CDD:275368 10/19 (53%)
C2H2 Zn finger 450..468 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.