DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZFP69B

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_005271193.1 Gene:ZFP69B / 65243 HGNCID:28053 Length:535 Species:Homo sapiens


Alignment Length:386 Identity:110/386 - (28%)
Similarity:159/386 - (41%) Gaps:88/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 FTSDVGEEPLYASEDRDDEPEDSFQLKPRPDEIENRELSRPSQLGSR-------LNHSANF---- 201
            ||.:.|:|    |...:.......::.|.|..:..:...:....|.|       :|||.::    
Human   218 FTQERGQE----SNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMK 278

  Fly   202 IYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHM 266
            .::|.:|.::|.:...||.|             |::   ..|.....|:.|.:.|.:..:|..| 
Human   279 TFECNICEKIFKQLIHLTEH-------------MRI---HTGEKPFRCKECGKAFSQSSSLIPH- 326

  Fly   267 QAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSF--PVSSLTIHIRRHTGDNPYKCDQCEKA 329
            |..|..                  .|..:|..||.:|  | ||||.|:|.|||:.||:|..||||
Human   327 QRIHTG------------------EKPYECKECGKTFRHP-SSLTQHVRIHTGEKPYECRVCEKA 372

  Fly   330 FPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKI 394
            |.:|..|..|:|.|..|:|..||.|.|.|.....|.:|..:|||.:||.|.:|||:|..|..|..
Human   373 FSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYICNVCSKTFSHSTYLTQ 437

  Fly   395 HMRRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSE 459
            |.|.|||||||:|..||::|....||:||:               ..:....||..:...:....
Human   438 HQRTHTGERPYKCKECGKAFSQRIHLSIHQ---------------RVHTGVKPYECSHCGKAFRH 487

  Fly   460 DIERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALLTVH-----RNKMSH 515
            |....:.|||...:         ||      |.|..|.:.|...:.|..|     ||..|:
Human   488 DSSFAKHQRIHTGE---------KP------YDCNECGKAFSCSSSLIRHCKTHLRNTFSN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 47/98 (48%)
C2H2 Zn finger 296..315 CDD:275368 11/20 (55%)
zf-H2C2_2 307..330 CDD:290200 14/22 (64%)
C2H2 Zn finger 323..343 CDD:275368 10/19 (53%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 12/23 (52%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
zf-H2C2_2 391..416 CDD:290200 14/24 (58%)
C2H2 Zn finger 407..424 CDD:275368 7/16 (44%)
ZFP69BXP_005271193.1 SCAN <2..40 CDD:383046
KRAB 74..134 CDD:214630
COG5048 <194..430 CDD:227381 73/251 (29%)
C2H2 Zn finger 258..274 CDD:275368 5/15 (33%)
C2H2 Zn finger 282..302 CDD:275368 7/35 (20%)
C2H2 Zn finger 310..330 CDD:275368 6/20 (30%)
C2H2 Zn finger 338..358 CDD:275368 11/20 (55%)
C2H2 Zn finger 366..386 CDD:275368 10/19 (53%)
C2H2 Zn finger 394..414 CDD:275368 7/19 (37%)
C2H2 Zn finger 422..442 CDD:275368 9/19 (47%)
zf-H2C2_2 434..459 CDD:372612 14/24 (58%)
C2H2 Zn finger 450..470 CDD:275368 8/34 (24%)
zf-H2C2_2 462..487 CDD:372612 6/39 (15%)
C2H2 Zn finger 478..498 CDD:275368 3/19 (16%)
zf-H2C2_2 490..515 CDD:372612 9/39 (23%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.