DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and GZF1

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001303941.1 Gene:GZF1 / 64412 HGNCID:15808 Length:711 Species:Homo sapiens


Alignment Length:418 Identity:115/418 - (27%)
Similarity:168/418 - (40%) Gaps:112/418 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PMHLCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEVA------------AKPDEVHVDVVELI 113
            |....:..:.||.|...| ||:.....| :.|.|||:.|            ..||.|..:     
Human   215 PYPKIRRASGRLAGRKVF-VEIPKKKYT-RRLREQQKTAEGDVGDYRCPQDQSPDRVGTE----- 272

  Fly   114 DQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEPEDSFQLKPRPD 178
                   |.|.......:...|:||         .:...|.|     |:.::|.||        :
Human   273 -------MEQVSKNEGCQAGAELEE---------LSKKAGPE-----EEEEEEEED--------E 308

  Fly   179 EIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCG 243
            |.|.::              :||  ||::|.:.|...:|..:|....|.:..:|.   ...::||
Human   309 EGEKKK--------------SNF--KCSICEKAFLYEKSFLKHSKHRHGVATEVV---YRCDTCG 354

  Fly   244 TGL-------------------LTCEHCPRTFKRQDTLRRHMQAFH----------------PDA 273
            ...                   ..||.|.:.|||:..::||:...|                ...
Human   355 QTFANRCNLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSK 419

  Fly   274 IALEPEETTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLS 337
            .||...|.|....|.     ..|..||..| ..|:|..|:|.|||:.|:.||:|...|.::..|.
Human   420 TALRLHERTHTGDRP-----YGCTECGARFSQPSALKTHMRIHTGEKPFVCDECGARFTQNHMLI 479

  Fly   338 LHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGE 402
            .|.|.||||||..|:.|.|.|.|:..|..|.|:|||.:|:.|::|.::|.|.|.|..|::.||||
Human   480 YHKRCHTGERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGE 544

  Fly   403 RPYQCGVCGESFVCGSHLN-IHRNRKGH 429
            |||.|..||:.|   :.|| :.|:|:.|
Human   545 RPYCCDQCGKQF---TQLNALQRHRRIH 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 8/30 (27%)
C2H2 Zn finger 205..226 CDD:275368 5/20 (25%)
C2H2 Zn finger 249..266 CDD:275368 7/16 (44%)
COG5048 <294..>391 CDD:227381 41/97 (42%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 364..388 CDD:290200 10/23 (43%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..424 CDD:275368 6/17 (35%)
GZF1NP_001303941.1 BTB 21..133 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..220 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..312 20/102 (20%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..371 CDD:275368 2/20 (10%)
COG5048 <405..593 CDD:227381 65/173 (38%)
C2H2 Zn finger 409..429 CDD:275368 3/19 (16%)
C2H2 Zn finger 437..457 CDD:275368 8/19 (42%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
C2H2 Zn finger 493..513 CDD:275368 8/19 (42%)
C2H2 Zn finger 521..541 CDD:275368 7/19 (37%)
C2H2 Zn finger 549..569 CDD:275368 8/22 (36%)
C2H2 Zn finger 577..597 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.