DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZBTB26

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001291292.1 Gene:ZBTB26 / 57684 HGNCID:23383 Length:441 Species:Homo sapiens


Alignment Length:478 Identity:92/478 - (19%)
Similarity:175/478 - (36%) Gaps:168/478 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTPEIHVNI--SSQTCRVCLETHETNLYVHDEIK-YNDLK----LELWQLLEAVSKLKWTWTDPN 59
            |:.|:.::|  ||:..|..|.:..:.:....|:: .|.|.    |::..::|..::..|.:..|.
Human    66 DSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFLQMSHIVERCTQALWKFIKPK 130

  Fly    60 LPMHLCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEVAAKPDE----VH--VDVVELIDQDDV 118
            .||...:.|            |.::|  :.|:..:|.:....|.:    :|  .|.:::.|.|..
Human   131 QPMDSKEGC------------EPQSA--SPQSKEQQGDARGSPKQDSPCIHPSEDSMDMEDSDIQ 181

  Fly   119 VSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEP--LYASEDRDDEPEDSF---QLKPRPD 178
            :...:.:.        ::.|....:|.:.|   :..||  |::|     ||:.|.   .::.|..
Human   182 IVKVESIG--------DVSEVRSKKDQNQF---ISSEPTALHSS-----EPQHSLINSTVENRVS 230

  Fly   179 EIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCG 243
            |||.             ||..|:...       :..|:::             :.|.|       
Human   231 EIEQ-------------NHLHNYALS-------YTGSDNI-------------IMASK------- 255

  Fly   244 TGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFPVSSL 308
                                   ..|.|:...::.                     ||.:     
Human   256 -----------------------DVFGPNIRGVDK---------------------GLQW----- 271

  Fly   309 TIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTG 373
                  |     ::|.:|.:.|...::.:.|::.|   :...|.:|.|.|..:..|.||||:|.|
Human   272 ------H-----HQCPKCTRVFRHLENYANHLKMH---KLFMCLLCGKTFTQKGNLHRHMRVHAG 322

  Fly   374 QRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNE 438
            .:|:.||:|.|:|.|...|:.|:..|:|::|::|..|...|   :|..:.|.   ||..:...|.
Human   323 IKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVF---AHKPVLRK---HLKQLHGKNS 381

  Fly   439 VEANFAADPYVNARVNQRRSEDI 461
            .:         ||  |:|..:|:
Human   382 FD---------NA--NERNVQDL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 15/82 (18%)
C2H2 Zn finger 205..226 CDD:275368 1/20 (5%)
C2H2 Zn finger 249..266 CDD:275368 0/16 (0%)
COG5048 <294..>391 CDD:227381 26/96 (27%)
C2H2 Zn finger 296..315 CDD:275368 2/18 (11%)
zf-H2C2_2 307..330 CDD:290200 3/22 (14%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 335..358 CDD:290200 5/22 (23%)
C2H2 Zn finger 351..371 CDD:275368 9/19 (47%)
zf-H2C2_2 364..388 CDD:290200 13/23 (57%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 8/24 (33%)
C2H2 Zn finger 407..424 CDD:275368 4/16 (25%)
ZBTB26NP_001291292.1 BTB_POZ_ZBTB26_Bioref 8..129 CDD:349523 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..177 8/56 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..216 6/29 (21%)
COG5236 <269..>381 CDD:227561 37/136 (27%)
C2H2 Zn finger 275..295 CDD:275368 4/19 (21%)
zf-C2H2 298..320 CDD:395048 9/21 (43%)
C2H2 Zn finger 300..320 CDD:275368 9/19 (47%)
zf-H2C2_2 315..337 CDD:404364 12/21 (57%)
C2H2 Zn finger 328..348 CDD:275368 8/19 (42%)
C2H2 Zn finger 356..374 CDD:275368 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.