DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and si:ch211-79k12.2

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001313520.1 Gene:si:ch211-79k12.2 / 568844 ZFINID:ZDB-GENE-131121-535 Length:555 Species:Danio rerio


Alignment Length:346 Identity:110/346 - (31%)
Similarity:153/346 - (44%) Gaps:59/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQ 267
            :.|..|.|.|.....|.|| .|.|.            :..|...|:|.||..:|.|...|.:|.:
Zfish   248 FPCLSCQRTFPTCAQLLRH-EQGHA------------QQDGLQQLSCMHCNASFPRPSQLLQHQR 299

  Fly   268 AFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIRRHTGDNPYKCDQCEKAFP 331
            ..|               |.|  |....|..||.:| ..|:|.||:..|||..||.|..|.|:|.
Zfish   300 TQH---------------ATK--AGGFLCAECGRAFNSHSNLRIHLNVHTGARPYICTNCGKSFS 347

  Fly   332 RSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHM 396
            :|..|.:|.|.||||||..|..|.:.|.....:..|.|:|||::||.|..|.|.|.||..||||.
Zfish   348 QSGALKIHRRIHTGERPYTCSYCGRGFPHLAGVRAHQRIHTGEKPYICGQCGKCFTQSGALKIHT 412

  Fly   397 RRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSEDI 461
            |.||||||:.||:||:||...|.:..|..       .:.|..:|.|....|.:.|..:.:.| ||
Zfish   413 RIHTGERPFVCGLCGKSFSNRSGIRFHHR-------TVHGIVMEPNSVGRPSLAASASSQVS-DI 469

  Fly   462 ERMRLQRIPE---NQLQQRLENLP--------------KPDVPAMCYKCGVCEQKFKSGALLTVH 509
            :|:::..:.:   .|:::|  |||              ..|..|:.|.|..|.|:|........|
Zfish   470 QRVQVSAVNQIHFRQIEER--NLPSKELVQPSKEQLSGNADKLALPYACEDCGQRFPDAPSRNRH 532

  Fly   510 RNKMSHYEIERVYENPFGKNQ 530
            :. :.||.:|...:...|.::
Zfish   533 QT-LQHYSLEEQEKEDTGSSK 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 8/20 (40%)
C2H2 Zn finger 249..266 CDD:275368 6/16 (38%)
COG5048 <294..>391 CDD:227381 43/97 (44%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 11/22 (50%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 11/23 (48%)
C2H2 Zn finger 379..399 CDD:275368 11/19 (58%)
zf-H2C2_2 391..416 CDD:290200 17/24 (71%)
C2H2 Zn finger 407..424 CDD:275368 7/16 (44%)
si:ch211-79k12.2NP_001313520.1 C2H2 Zn finger 281..302 CDD:275368 7/20 (35%)
C2H2 Zn finger 311..331 CDD:275368 8/19 (42%)
zf-H2C2_2 323..348 CDD:290200 12/24 (50%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
zf-H2C2_2 351..374 CDD:290200 11/22 (50%)
C2H2 Zn finger 367..387 CDD:275368 5/19 (26%)
zf-H2C2_2 380..404 CDD:290200 11/23 (48%)
C2H2 Zn finger 395..415 CDD:275368 11/19 (58%)
zf-H2C2_2 407..432 CDD:290200 17/24 (71%)
C2H2 Zn finger 423..442 CDD:275368 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11892
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.