DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and znf711

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001352539.1 Gene:znf711 / 562505 ZFINID:ZDB-GENE-081107-49 Length:765 Species:Danio rerio


Alignment Length:365 Identity:99/365 - (27%)
Similarity:145/365 - (39%) Gaps:83/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 QYLSTSFAEQHVE------MEEKYGDQDCSAFTSD--------------------VGEEPLYASE 161
            ::.|..|.::|::      .::||...||. ||::                    :.|...|...
Zfish   395 KFKSRGFLKRHMKNHPDHMFKKKYQCTDCE-FTTNKKVSFHNHLESHKLIIKNEKIPEYTEYTRR 458

  Fly   162 DRDDEPEDSFQL-----KPRPDEIENRELSRPSQLGSRLN------HSANFIYKCAVCPRVFAKS 215
            ..:..|..|.:|     :|:..:.:..|.....|  ..||      ||.||.:.|..|.:.|...
Zfish   459 YHEASPLSSNKLILRDKEPKLHKCKYCEYETAEQ--GLLNRHLLAVHSKNFAHVCVECAKGFRHP 521

  Fly   216 ESLTRHFSQAHK------------LTADVAAMKLANES-CGTGL-LTCEHCPRTFKRQDTLRRHM 266
            ..|.:|. :.|.            ..||.:.:|...:| .||.| ..|.|||:.|.....|:||.
Zfish   522 SELKKHM-RTHTGEKPFHCQHCEFSCADQSNLKTHIKSKHGTDLPFKCGHCPQAFADDKELQRHA 585

  Fly   267 QAFHPDAIALEPEETTDNSARKRIAKRRDCPHC-GLSFPVSSLTIH-IRRHTGDNPYKCDQCEKA 329
            :.|...                   |...|||| ..|...|.|..| |..||.|.|:|||.|||.
Zfish   586 EIFQGH-------------------KTHQCPHCEHKSTNSSDLKRHIISVHTKDFPHKCDVCEKG 631

  Fly   330 FPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARH-MRLHTGQRPYSCKMCSKSFVQSNDLK 393
            |.|..:|..|...|.|.:..:|:.|..|.:....|:|| :.:||...|:.||.|.:.|...|:||
Zfish   632 FHRPSELKKHSETHKGNKVHQCRHCDFKTLDPFTLSRHILSVHTKDLPFKCKRCKRGFRHQNELK 696

  Fly   394 IHMRRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAV 433
            .||:.|:|.:.|||..|..:....|..      |.|:|::
Zfish   697 KHMKTHSGRKVYQCQYCEYNTTDASGF------KRHVISI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 5/20 (25%)
C2H2 Zn finger 249..266 CDD:275368 7/16 (44%)
COG5048 <294..>391 CDD:227381 38/99 (38%)
C2H2 Zn finger 296..315 CDD:275368 9/20 (45%)
zf-H2C2_2 307..330 CDD:290200 13/23 (57%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 6/22 (27%)
C2H2 Zn finger 351..371 CDD:275368 6/20 (30%)
zf-H2C2_2 364..388 CDD:290200 10/24 (42%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
zf-H2C2_2 391..416 CDD:290200 10/24 (42%)
C2H2 Zn finger 407..424 CDD:275368 3/16 (19%)
znf711NP_001352539.1 Zfx_Zfy_act 64..368 CDD:309717
COG5048 385..763 CDD:227381 99/365 (27%)
C2H2 Zn finger 389..409 CDD:275368 3/13 (23%)
C2H2 Zn finger 482..503 CDD:275368 4/22 (18%)
C2H2 Zn finger 511..531 CDD:275368 5/20 (25%)
C2H2 Zn finger 539..560 CDD:275368 4/20 (20%)
C2H2 Zn finger 568..584 CDD:275368 6/15 (40%)
C2H2 Zn finger 596..617 CDD:275368 9/20 (45%)
C2H2 Zn finger 625..645 CDD:275368 9/19 (47%)
C2H2 Zn finger 682..702 CDD:275368 9/19 (47%)
C2H2 Zn finger 710..731 CDD:275368 6/27 (22%)
C2H2 Zn finger 739..759 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.