DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZNF705A

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_024304748.1 Gene:ZNF705A / 440077 HGNCID:32281 Length:315 Species:Homo sapiens


Alignment Length:188 Identity:61/188 - (32%)
Similarity:93/188 - (49%) Gaps:31/188 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RQDTL-RRHMQAFHP----DA----------IALEPEETTDNSARKRIAKRRDCPHCGLSFPVSS 307
            |:..| ::||.:.||    ||          |..:|.|..|:.        .||.|.      |:
Human    95 RESALKKKHMISMHPITRKDASTSMTMENSLILEDPFECNDSG--------EDCTHS------ST 145

  Fly   308 LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHT 372
            :|..:..|:|..||...||.|:.........|.:.||..:..:|.:|.|.:.:..:|.||...||
Human   146 ITQRLLTHSGKKPYVSKQCGKSLRNLFSPKPHKQIHTKGKSYQCNLCEKAYTNCFRLRRHKMTHT 210

  Fly   373 GQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHL 430
            |:|||:|.:|.|:|.|.:.|:.|.:.|||||||:|..||::|:  ...|:.|:.:.||
Human   211 GERPYACHLCGKAFTQCSHLRRHEKTHTGERPYKCHQCGKAFI--QSFNLRRHERTHL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368
C2H2 Zn finger 249..266 CDD:275368 2/8 (25%)
COG5048 <294..>391 CDD:227381 32/96 (33%)
C2H2 Zn finger 296..315 CDD:275368 4/18 (22%)
zf-H2C2_2 307..330 CDD:290200 8/22 (36%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 335..358 CDD:290200 6/22 (27%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 13/23 (57%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..424 CDD:275368 5/16 (31%)
ZNF705AXP_024304748.1 KRAB 22..81 CDD:214630
C2H2 Zn finger 133..153 CDD:275368 6/33 (18%)
COG5048 <136..315 CDD:227381 49/147 (33%)
C2H2 Zn finger 162..181 CDD:275368 4/18 (22%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
zf-H2C2_2 201..226 CDD:316026 13/24 (54%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:316026 13/26 (50%)
C2H2 Zn finger 245..265 CDD:275368 6/21 (29%)
C2H2 Zn finger 273..293 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.