DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and trem

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:513 Identity:130/513 - (25%)
Similarity:207/513 - (40%) Gaps:130/513 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CRVCLET-HETNLYVHDEIKYNDLKLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARRLIGAYEF 78
            |||||.. .|....:|| |........|.|:|...:.:..: .|.|.|..:|..|.|.|...|:|
  Fly    12 CRVCLNNPSEGEELLHD-IFSETASTRLDQMLHICAGIPVS-LDDNFPDKMCSKCVRCLRLCYKF 74

  Fly    79 IVEVENAHETLQNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLST--------SFAEQ--- 132
            .:..:.:|:.:.::.:::...|          ....:.|::|:|:.||.        .:|.|   
  Fly    75 RLTCQRSHQHIMDMLDREASNA----------NAAGEGDLLSIAEDLSVESVLKSWEDYASQLDG 129

  Fly   133 --HVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEPEDSFQL----KPRPDEIENRELSRPSQL 191
              .||.||   ||.....|        |..||.|.:..:.|.:    :|.|:|||..|       
  Fly   130 GMKVEGEE---DQQHQVIT--------YVVEDGDTDDTNMFDVHDPTQPVPNEIEEAE------- 176

  Fly   192 GSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANE--SCGTGLLTCEHCPR 254
                               .:|:.|.        ::|..:..:.::|.|  |.||.:.| |..|.
  Fly   177 -------------------TYAEYEE--------YELLTNENSPEIAQEKGSTGTDVAT-EEPPE 213

  Fly   255 TFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRD-----------------------C 296
            ....:|.|......   |....:||: .|.|.||.:|..::                       |
  Fly   214 EEIAEDILDSDEDY---DPTHAKPEK-CDRSGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYIC 274

  Fly   297 PHCGLSFPVSS-LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFIS 360
            ..||..:|..: ||.|::.|:|..|::|:.|.:.|.::|.|..||..|||.||.:|..|...|..
  Fly   275 DVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFAD 339

  Fly   361 QNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIHRN 425
            ::...:|.|:||.:|||.|.:||::|..|::||.|...||||:|:.|.:||:.||....|.:||.
  Fly   340 RSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRE 404

  Fly   426 RKGHLIAVIPGNEVEANFAADPYVNARVNQRRSEDIERMRLQRIPENQLQQRLENLPK 483
            .....|.               :.|......::||:         :.:..:.|..|||
  Fly   405 THNRRIT---------------WRNDAEESTKAEDV---------KGETPEFLNELPK 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 22/77 (29%)
C2H2 Zn finger 205..226 CDD:275368 2/20 (10%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 37/120 (31%)
C2H2 Zn finger 296..315 CDD:275368 7/19 (37%)
zf-H2C2_2 307..330 CDD:290200 8/23 (35%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 11/23 (48%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 12/24 (50%)
C2H2 Zn finger 407..424 CDD:275368 6/16 (38%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 22/76 (29%)
COG5048 <264..411 CDD:227381 53/146 (36%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 10/22 (45%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 11/23 (48%)
C2H2 Zn finger 386..406 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.