DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Bcl6b

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001101749.1 Gene:Bcl6b / 360551 RGDID:1563179 Length:472 Species:Rattus norvegicus


Alignment Length:387 Identity:99/387 - (25%)
Similarity:135/387 - (34%) Gaps:119/387 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEPL-----------------------YA 159
            |::.|.||..    :||.       |.|..|. ....|||                       ..
  Rat   111 VLAAATYLQM----EHVV-------QACHRFI-QASYEPLGISLRPMEAEPPRPPTVPPPGSPRR 163

  Fly   160 SEDRDDEPEDS---FQLKPRPDEIENREL-----------SRPSQLGSRLNHSANFIYKCAVCPR 210
            ||...|.|.:|   .|..|.|...:.:..           |:.||.||....|:.     ..||:
  Rat   164 SEGHPDPPTESRSCSQGSPSPASPDPKACNWKKYKFIVLNSQSSQAGSLAGESSG-----QPCPQ 223

  Fly   211 V--------------FAKSESLTRHFSQAHKLTADVAAMK---LANESC---------------- 242
            .              .:..|..|........|....|..|   |||.|.                
  Rat   224 ARLPSGDEACSSSSSSSSEEGATPGLQSRLSLATTTARFKCGALANNSYLFTPPAQETSKQAHPP 288

  Fly   243 -GTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIA-----LEPEETTDNSARKRIAKRRDCPHCGL 301
             |:..|:|::|                   :|:|     :||....|..      |...|..|..
  Rat   289 PGSECLSCQNC-------------------EAVAGCSSGIEPLAPGDED------KPYKCQLCRS 328

  Fly   302 SFPV-SSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLA 365
            :|.. .:|..|...|||:.||:|..|...|.|..:|..|.|.|:||:|.:|:.|..:|:....|.
  Rat   329 AFRYKGNLASHRTVHTGEKPYRCSVCGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLR 393

  Fly   366 RHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIHRNRK 427
            .|:.:|||::||.|..|...|.....||.|:|.||||:||.|..||..|...|.|.:|..:|
  Rat   394 AHVLIHTGEKPYPCPTCGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 4/34 (12%)
C2H2 Zn finger 249..266 CDD:275368 2/16 (13%)
COG5048 <294..>391 CDD:227381 34/97 (35%)
C2H2 Zn finger 296..315 CDD:275368 5/19 (26%)
zf-H2C2_2 307..330 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 9/22 (41%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 10/23 (43%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 14/24 (58%)
C2H2 Zn finger 407..424 CDD:275368 6/16 (38%)
Bcl6bNP_001101749.1 BTB 28..132 CDD:279045 9/32 (28%)
BTB 39..131 CDD:197585 8/30 (27%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
zf-H2C2_2 335..360 CDD:290200 10/24 (42%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 363..388 CDD:290200 10/24 (42%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
zf-H2C2_2 391..416 CDD:290200 10/24 (42%)
C2H2 Zn finger 407..427 CDD:275368 7/19 (37%)
zf-H2C2_2 420..444 CDD:290200 14/23 (61%)
C2H2 Zn finger 435..453 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.