DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZFP69

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001307107.1 Gene:ZFP69 / 339559 HGNCID:24708 Length:527 Species:Homo sapiens


Alignment Length:472 Identity:126/472 - (26%)
Similarity:191/472 - (40%) Gaps:127/472 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EVENAHETLQNLFEQQEVAAKPDEVHVDVVELIDQDDVV-SMAQYLST--SFAEQHVE------- 135
            ::|....|.::...|:.:      .|..::|...:||:: |..:.:||  ...|:|.|       
Human   153 KIETIESTAKSTISQERL------YHGIMMESFMRDDIIYSTLRKVSTYDDVLERHQETCMRDVR 211

  Fly   136 ---MEEKYGDQDCSAFTSDVGEEPLYASEDRD---DEP--EDSFQLKPRPDEIENRELSRPSQLG 192
               :..|...|:.:.|..::........|.|.   |.|  .::::|                   
Human   212 QAILTHKKRVQETNKFGENIIVHSNVIIEQRHHKYDTPTKRNTYKL------------------- 257

  Fly   193 SRLNHSANFI----YKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCP 253
            ..:||..::|    |:|.:|.::|.:...||.|             |::   ..|.....|:.|.
Human   258 DLINHPTSYIRTKTYECNICEKIFKQPIHLTEH-------------MRI---HTGEKPFRCKECG 306

  Fly   254 RTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIRRHTG 317
            |.|.:..:|..| |..|..                  .|..:|..||.:| ..|||..|.|.|||
Human   307 RAFSQSASLSTH-QRIHTG------------------EKPFECEECGKAFRHRSSLNQHHRTHTG 352

  Fly   318 DNPYKCDQCEKAFPRSQDLSL--HMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCK 380
            :.||.||:|:|||  ||::||  |:|.|:||:|..|..|.|.|.....|:.|:|:|||::||:|.
Human   353 EKPYVCDKCQKAF--SQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACT 415

  Fly   381 MCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPG-NEVEANFA 444
            .|.|:|.....|..|.|.|||||||:|..||::|....||:.|:       .|..| ...|.|..
Human   416 ACCKTFSHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHK-------TVHTGVKAYECNRC 473

  Fly   445 ADPYVNARVNQRRSEDIERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALLTVH 509
            ...|       |.....::           .||.....||      |:|..|.:.|...:.|:  
Human   474 GKAY-------RHDSSFKK-----------HQRHHTGEKP------YECNECGKAFSYNSSLS-- 512

  Fly   510 RNKMSHYEIERVYENPF 526
                .|:||.|  .|.|
Human   513 ----RHHEIHR--RNAF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 2/10 (20%)
C2H2 Zn finger 205..226 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 46/99 (46%)
C2H2 Zn finger 296..315 CDD:275368 9/19 (47%)
zf-H2C2_2 307..330 CDD:290200 13/22 (59%)
C2H2 Zn finger 323..343 CDD:275368 12/21 (57%)
zf-H2C2_2 335..358 CDD:290200 11/24 (46%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 12/23 (52%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 14/24 (58%)
C2H2 Zn finger 407..424 CDD:275368 6/16 (38%)
ZFP69NP_001307107.1 SCAN <3..66 CDD:383046
KRAB 76..137 CDD:214630
COG5048 <233..516 CDD:227381 105/375 (28%)
C2H2 Zn finger 274..294 CDD:275368 7/35 (20%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
C2H2 Zn finger 330..350 CDD:275368 9/19 (47%)
C2H2 Zn finger 358..378 CDD:275368 12/21 (57%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
C2H2 Zn finger 442..462 CDD:275368 7/26 (27%)
C2H2 Zn finger 498..518 CDD:275368 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.