DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZBTB48

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001265576.1 Gene:ZBTB48 / 3104 HGNCID:4930 Length:688 Species:Homo sapiens


Alignment Length:292 Identity:80/292 - (27%)
Similarity:124/292 - (42%) Gaps:64/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LNHSANFIYKCAVCPRVFAKSESLTRHFSQAHK--------------LTADVAAMKLANESCGTG 245
            ::|:....|||:.|.:.|.:.:.|..|..:.|.              |:.....:..|.:..|..
Human   370 VSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFKHRGEK 434

  Fly   246 LLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPH----CGLSF-PV 305
            |..||.|......::.|:.|::|.|                      |.:.||    |..:| ..
Human   435 LFVCEECGHRASSRNGLQMHIKAKH----------------------RNERPHVCEFCSHAFTQK 477

  Fly   306 SSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHM-R 369
            ::|.:|:|.|||:.|::|..|.|.|.....|..|.|.||||||..|:.|.::|..:..|.||: .
Human   478 ANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHVAS 542

  Fly   370 LHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH----------- 423
            .|...||:.|::|.|:|.....|::|:|||.|.|.::|..||..|...:||..|           
Human   543 RHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIHDRVENYN 607

  Fly   424 -RNRKGH----------LIAVIPGNEVEANFA 444
             |.||..          ::|:.|..|:|...|
Human   608 PRQRKLRNLIIEDEKMVVVALQPPAELEVGSA 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 5/20 (25%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 37/102 (36%)
C2H2 Zn finger 296..315 CDD:275368 7/23 (30%)
zf-H2C2_2 307..330 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 6/20 (30%)
zf-H2C2_2 364..388 CDD:290200 10/24 (42%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 11/24 (46%)
C2H2 Zn finger 407..424 CDD:275368 7/28 (25%)
ZBTB48NP_001265576.1 BTB 16..119 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..192
C2H2 Zn finger 293..313 CDD:275368
zf-H2C2_2 305..328 CDD:316026
C2H2 Zn finger 321..372 CDD:275368 0/1 (0%)
SFP1 <374..459 CDD:227516 18/84 (21%)
C2H2 Zn finger 380..401 CDD:275368 5/20 (25%)
C2H2 Zn finger 409..425 CDD:275370 1/15 (7%)
C2H2 Zn finger 438..459 CDD:275368 6/20 (30%)
COG5048 <464..612 CDD:227381 52/147 (35%)
C2H2 Zn finger 467..487 CDD:275368 5/19 (26%)
C2H2 Zn finger 495..515 CDD:275368 7/19 (37%)
C2H2 Zn finger 523..540 CDD:275368 5/16 (31%)
C2H2 Zn finger 555..572 CDD:275368 6/16 (38%)
C2H2 Zn finger 580..600 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.