Sequence 1: | NP_650132.1 | Gene: | CG3281 / 41445 | FlyBaseID: | FBgn0260741 | Length: | 538 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265576.1 | Gene: | ZBTB48 / 3104 | HGNCID: | 4930 | Length: | 688 | Species: | Homo sapiens |
Alignment Length: | 292 | Identity: | 80/292 - (27%) |
---|---|---|---|
Similarity: | 124/292 - (42%) | Gaps: | 64/292 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 LNHSANFIYKCAVCPRVFAKSESLTRHFSQAHK--------------LTADVAAMKLANESCGTG 245
Fly 246 LLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPH----CGLSF-PV 305
Fly 306 SSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHM-R 369
Fly 370 LHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH----------- 423
Fly 424 -RNRKGH----------LIAVIPGNEVEANFA 444 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3281 | NP_650132.1 | zf-AD | 14..92 | CDD:285071 | |
C2H2 Zn finger | 205..226 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 249..266 | CDD:275368 | 4/16 (25%) | ||
COG5048 | <294..>391 | CDD:227381 | 37/102 (36%) | ||
C2H2 Zn finger | 296..315 | CDD:275368 | 7/23 (30%) | ||
zf-H2C2_2 | 307..330 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 323..343 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 335..358 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 351..371 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 364..388 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 379..399 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 391..416 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 407..424 | CDD:275368 | 7/28 (25%) | ||
ZBTB48 | NP_001265576.1 | BTB | 16..119 | CDD:306997 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 119..140 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..192 | ||||
C2H2 Zn finger | 293..313 | CDD:275368 | |||
zf-H2C2_2 | 305..328 | CDD:316026 | |||
C2H2 Zn finger | 321..372 | CDD:275368 | 0/1 (0%) | ||
SFP1 | <374..459 | CDD:227516 | 18/84 (21%) | ||
C2H2 Zn finger | 380..401 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 409..425 | CDD:275370 | 1/15 (7%) | ||
C2H2 Zn finger | 438..459 | CDD:275368 | 6/20 (30%) | ||
COG5048 | <464..612 | CDD:227381 | 52/147 (35%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 523..540 | CDD:275368 | 5/16 (31%) | ||
C2H2 Zn finger | 555..572 | CDD:275368 | 6/16 (38%) | ||
C2H2 Zn finger | 580..600 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |