DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Zscan21

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001012021.1 Gene:Zscan21 / 304342 RGDID:1309981 Length:554 Species:Rattus norvegicus


Alignment Length:443 Identity:118/443 - (26%)
Similarity:176/443 - (39%) Gaps:80/443 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTPEIHVNISSQTCRVCLETHETNLYVHDEIKYNDLKLELW---QLLEAVSKLKWTWTDPNLPMH 63
            |||.....: ||...:|.|..:..::..::|      |||.   |.|..:.:....|..      
  Rat   132 DTPGPREAL-SQLRVLCCEWLQPEIHTKEQI------LELLVLEQFLTILPRELQAWVQ------ 183

  Fly    64 LCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLSTS 128
              |:|......|...:.::|      |.|.|.....:.|:|..    :..::......|....:|
  Rat   184 --QHCPESAEEAVTLLEDLE------QELDEPGLQVSSPNEQK----QSWEKISTSGTAMESLSS 236

  Fly   129 FAEQHVEMEEKY---GDQDCSAFTSDVGEEPLYASEDRDDEPEDSFQLKPRPDEIENRELSRPSQ 190
            ...|.|:...||   |    ..:..:.|||.::.   :|......|:|.|:.::..:.:.|...:
  Rat   237 TETQPVDASPKYEFWG----PLYIQETGEEEVFT---QDPRKRQGFKLNPQKEDSADEQRSSEEE 294

  Fly   191 LGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKL---------TADVAAMK-----LANES 241
                 :|:...  |..:.|.:.|...........|:.|         ..|..:.|     .|..:
  Rat   295 -----SHAGGL--KRNIMPMITANKYGSRSERQWANNLERERGAKASLQDTGSRKGAEPASARPA 352

  Fly   242 CGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFPVS 306
            .|.....|..|.:.|.....|.:|.:              |....:..:     |..||.:|..|
  Rat   353 PGEKRYICAECGKAFSNSSNLTKHRR--------------THTGEKPYV-----CTKCGKAFSHS 398

  Fly   307 S-LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRL 370
            | ||:|.|.|..|.||.| :|.|||.:|.||..|.|.||.|.|.:||.|.|.|..:..|.||.|:
  Rat   399 SNLTLHYRTHLVDRPYDC-KCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRI 462

  Fly   371 HTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH 423
            |||::||.|..|.|||.|...|..|.|.||||:||:|..||::|...|:.|.|
  Rat   463 HTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKH 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 14/80 (18%)
C2H2 Zn finger 205..226 CDD:275368 2/20 (10%)
C2H2 Zn finger 249..266 CDD:275368 4/16 (25%)
COG5048 <294..>391 CDD:227381 48/97 (49%)
C2H2 Zn finger 296..315 CDD:275368 10/19 (53%)
zf-H2C2_2 307..330 CDD:290200 12/23 (52%)
C2H2 Zn finger 323..343 CDD:275368 10/19 (53%)
zf-H2C2_2 335..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 9/19 (47%)
zf-H2C2_2 364..388 CDD:290200 14/23 (61%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..424 CDD:275368 7/17 (41%)
Zscan21NP_001012021.1 SCAN 119..229 CDD:128708 23/121 (19%)
COG5048 <338..534 CDD:227381 73/198 (37%)
C2H2 Zn finger 360..380 CDD:275368 5/33 (15%)
C2H2 Zn finger 388..408 CDD:275368 10/19 (53%)
C2H2 Zn finger 418..435 CDD:275368 9/16 (56%)
C2H2 Zn finger 443..463 CDD:275368 9/19 (47%)
C2H2 Zn finger 471..491 CDD:275368 9/19 (47%)
C2H2 Zn finger 499..519 CDD:275368 7/17 (41%)
C2H2 Zn finger 527..547 CDD:275368
zf-C2H2 527..547 CDD:395048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.