DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Zbtb7b

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_038957970.1 Gene:Zbtb7b / 295248 RGDID:1305963 Length:597 Species:Rattus norvegicus


Alignment Length:449 Identity:118/449 - (26%)
Similarity:164/449 - (36%) Gaps:106/449 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LWQLLEAVSKLKWTWTDPNLPMHLCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEVAAKPDEV 105
            |..|||.......|.:..|:|..|   .|.||:   |....:....|.||....:   |..||| 
  Rat   153 LGALLEFAYTATLTTSSANMPAVL---QAARLL---EIPCVIAACMEILQGSGLE---APSPDE- 207

  Fly   106 HVDVVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDV--GEE-----PLYASEDR 163
                      ||.....|||            |.:.....:|.||.:  ||:     ||......
  Rat   208 ----------DDCERARQYL------------EAFATATTTASTSGMPNGEDSPPQVPLLPPPPP 250

  Fly   164 DDEPEDSFQLKPRPDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKL 228
            ...|......|||...::.:        |:|.||...........|..:.:.|.:.|..:.....
  Rat   251 PPRPVARRSRKPRKAFLQTK--------GARANHLVPEAPTVLTHPLAYEEEEMVGRVGNSGGSG 307

  Fly   229 TADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPDAI--------ALEPEETTDNS 285
            ..|       |.|...|..:....|..::..:......:..:|.|.        :|.|||     
  Rat   308 LGD-------NYSPPAGATSPAEGPLNYEVFEGEEEEEELVYPPAYGLAQSNEPSLSPEE----- 360

  Fly   286 ARKRIAKRRDCPHCGLSFPVSSLTIH--------------IRRHTGDNPYKCDQCEKAFPRSQDL 336
                :....|.....|...:|||  |              :|:.....|.:|..|.|....:..|
  Rat   361 ----LGSDEDPIDPDLMAYLSSL--HQDALAPGLDGQDKLVRKRRSQMPQECPVCHKIIHGAGKL 419

  Fly   337 SLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTG 401
            ..|||.||||:|..|::|..:|...:||..|||.|||:|||||..|...|:.|.|||.||..|||
  Rat   420 PRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNHMHLHTG 484

  Fly   402 ERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSED 460
            :|||:|.:|.::|....||  .|:.||.       |.:|          .|..:||.:|
  Rat   485 DRPYECHLCHKAFAKEDHL--QRHLKGQ-------NCLE----------VRTRRRRKDD 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 15/50 (30%)
C2H2 Zn finger 205..226 CDD:275368 3/20 (15%)
C2H2 Zn finger 249..266 CDD:275368 1/16 (6%)
COG5048 <294..>391 CDD:227381 39/110 (35%)
C2H2 Zn finger 296..315 CDD:275368 6/32 (19%)
zf-H2C2_2 307..330 CDD:290200 8/36 (22%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 364..388 CDD:290200 14/23 (61%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
zf-H2C2_2 391..416 CDD:290200 14/24 (58%)
C2H2 Zn finger 407..424 CDD:275368 5/16 (31%)
Zbtb7bXP_038957970.1 BTB_POZ_ZBTB7B_ZBTB15 63..196 CDD:349636 13/48 (27%)
COG5048 403..>482 CDD:227381 37/78 (47%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
zf-H2C2_2 421..443 CDD:404364 11/21 (52%)
C2H2 Zn finger 434..454 CDD:275368 8/19 (42%)
C2H2 Zn finger 462..482 CDD:275368 9/19 (47%)
zf-H2C2_2 474..499 CDD:404364 14/24 (58%)
C2H2 Zn finger 490..508 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.