DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZNF763

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001012771.1 Gene:ZNF763 / 284390 HGNCID:27614 Length:397 Species:Homo sapiens


Alignment Length:420 Identity:105/420 - (25%)
Similarity:155/420 - (36%) Gaps:112/420 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YNDLKLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARRLIGAYEFIVEVENAHETLQNLFEQQEV 98
            |.::.||.::.|.::.|   .|.|.|:              .||:    :|.....::|.|....
Human    32 YREVMLETFRNLTSIGK---KWKDQNI--------------EYEY----QNPRRNFRSLIEGNVN 75

  Fly    99 AAKPDEVHVDVVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFT-------------- 149
            ..|.|....:....:..|.:         :|.|:....|.|    .|..|.              
Human    76 EIKEDSHCGETFTQVPDDRL---------NFQEKKASPEAK----SCDNFVCGEVGIGNSSFNMN 127

  Fly   150 --SDVGEEPLYASED------RDDEPEDSFQLKPRPDEIENRELSRPSQLGSRLNHSANFIYKCA 206
              .|:|.: .|..:|      :..:|:.:|:.             .||......||:....|.|.
Human   128 IRGDIGHK-AYEYQDYAPKPYKCQQPKKAFRY-------------HPSFRTQERNHTGEKPYACK 178

  Fly   207 VCPRVFAKSESLTRHF---------------SQAHKLTADVAAMKLANESCGTG--LLTCEHCPR 254
            .|.:.|.....:.|..               ...|.|     .:.|.:|...||  ...|:.|.:
Human   179 ECGKTFISHSGIRRRMVMHSGDGPYKCKFCGKAVHCL-----RLYLIHERTHTGEKPYECKQCVK 238

  Fly   255 TFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIRRHTGD 318
            :|....|.|.|              |.|...     .|..:|..||.:| ..||...|.|.|||.
Human   239 SFSYSATHRIH--------------ERTHTG-----EKPYECQQCGKAFHSSSSFQAHKRTHTGG 284

  Fly   319 NPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCS 383
            .||:|.||.|:|.......:|.|.||||:|.||..|:|.|.|.....||.|.|||::||.||.|.
Human   285 KPYECKQCGKSFSWCHSFQIHERTHTGEKPCECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECR 349

  Fly   384 KSFVQSNDLKIHMRRHTGERPYQCGVCGES 413
            |:|...:.|:.|.|.|:.::||:|..||::
Human   350 KAFTYPSSLRRHERTHSAKKPYECKQCGKA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 11/57 (19%)
C2H2 Zn finger 205..226 CDD:275368 4/35 (11%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 44/97 (45%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 12/22 (55%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 364..388 CDD:290200 13/23 (57%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 9/23 (39%)
C2H2 Zn finger 407..424 CDD:275368 3/7 (43%)
ZNF763NP_001012771.1 KRAB 7..>49 CDD:214630 5/19 (26%)
KRAB 7..46 CDD:279668 4/13 (31%)
C2H2 Zn finger 149..169 CDD:275368 4/32 (13%)
COG5048 202..>390 CDD:227381 68/202 (34%)
C2H2 Zn finger 205..225 CDD:275368 4/24 (17%)
zf-H2C2_2 221..242 CDD:290200 6/20 (30%)
C2H2 Zn finger 233..253 CDD:275368 7/33 (21%)
zf-H2C2_2 247..270 CDD:290200 9/41 (22%)
C2H2 Zn finger 261..281 CDD:275368 8/19 (42%)
zf-H2C2_2 273..297 CDD:290200 12/23 (52%)
C2H2 Zn finger 289..309 CDD:275368 7/19 (37%)
zf-H2C2_2 301..326 CDD:290200 12/24 (50%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
zf-H2C2_2 332..354 CDD:290200 13/21 (62%)
DUF45 <342..383 CDD:302795 16/38 (42%)
C2H2 Zn finger 345..365 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.