| Sequence 1: | NP_650132.1 | Gene: | CG3281 / 41445 | FlyBaseID: | FBgn0260741 | Length: | 538 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036010907.1 | Gene: | Zbtb38 / 245007 | MGIID: | 2442866 | Length: | 1243 | Species: | Mus musculus |
| Alignment Length: | 251 | Identity: | 69/251 - (27%) |
|---|---|---|---|
| Similarity: | 101/251 - (40%) | Gaps: | 64/251 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 271 PDAIALEPEETTDNSARKRIAKRRDCPHC-----GLSFPVSSLTIHIRRHTGDNPYKCDQCEKAF 330
Fly 331 PRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIH 395
Fly 396 MRRHTGERPYQCGVCGESF-----------------------------VCGSHLNIHRNRKGHLI 431
Fly 432 AVIPGNE------------VEANFAADPYVNARVNQRRSEDIERM-RLQRIPENQL 474 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3281 | NP_650132.1 | zf-AD | 14..92 | CDD:285071 | |
| C2H2 Zn finger | 205..226 | CDD:275368 | |||
| C2H2 Zn finger | 249..266 | CDD:275368 | |||
| COG5048 | <294..>391 | CDD:227381 | 35/101 (35%) | ||
| C2H2 Zn finger | 296..315 | CDD:275368 | 4/23 (17%) | ||
| zf-H2C2_2 | 307..330 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 323..343 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 335..358 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 351..371 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 364..388 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 391..416 | CDD:290200 | 13/53 (25%) | ||
| C2H2 Zn finger | 407..424 | CDD:275368 | 4/45 (9%) | ||
| Zbtb38 | XP_036010907.1 | BTB_POZ_ZBTB38_CIBZ | 61..174 | CDD:349532 | |
| zf-C2H2_8 | <386..446 | CDD:406359 | |||
| C2H2 Zn finger | 388..408 | CDD:275368 | |||
| C2H2 Zn finger | 417..436 | CDD:275368 | |||
| C2H2 Zn finger | 506..526 | CDD:275368 | |||
| C2H2 Zn finger | 534..554 | CDD:275368 | |||
| C2H2 Zn finger | 562..580 | CDD:275368 | |||
| C2H2 Zn finger | 1061..1081 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 1074..1097 | CDD:404364 | 12/22 (55%) | ||
| zf-C2H2 | 1087..1109 | CDD:395048 | 8/21 (38%) | ||
| C2H2 Zn finger | 1089..1109 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 1117..1137 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 1145..1165 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 1176..1196 | CDD:275368 | 2/19 (11%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||