DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and Zbtb6

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_666365.1 Gene:Zbtb6 / 241322 MGIID:2442998 Length:423 Species:Mus musculus


Alignment Length:420 Identity:90/420 - (21%)
Similarity:150/420 - (35%) Gaps:149/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EIKYNDLKLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARRLIGAYEFIVEVENAHETLQNLFEQ 95
            |:|    :.||.:.|.|.|.|:.        :|:.:.|...|....|..:.::|...|  :|.:.
Mouse    94 EVK----RKELLKYLTAASYLQM--------VHIVEKCTEALSKYLEIDLSMKNNQHT--DLCQS 144

  Fly    96 QEVAAKPDEVHVD----VVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSDVGEEP 156
            .:...|.:|.:.|    ::| |.:|..|::         :.||:.||....|..:        |.
Mouse   145 SDTDVKNEEENSDKDCEIIE-ISEDSPVNL---------DFHVKEEESNALQSAA--------ET 191

  Fly   157 LYASEDRDDEPEDS-----FQLKP---------RPDEIENRELSRP---SQLGSRLNHSANFIYK 204
            |.:...|...||.|     |:...         ..|::||.:.|:|   |:.|.....:.:.:..
Mouse   192 LTSERMRMQSPELSAVDGGFKENEICILHVESISTDDVENGQFSQPCTSSKAGIYFPETQHSLIN 256

  Fly   205 CAVCPRV-----------FAKS-----------ESLTRHFSQAHKLTADVAAMKLANESCGTGLL 247
            ..|..||           |:::           ::|..:||..|:                    
Mouse   257 STVENRVTEVPGNTNQGLFSENSDGSHGTVNEIQNLDENFSLRHQ-------------------- 301

  Fly   248 TCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFPVSSLTIHI 312
             |..|||.|...:...||                                          |.:| 
Mouse   302 -CPRCPRGFLHVENYLRH------------------------------------------LKMH- 322

  Fly   313 RRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPY 377
                  ..:.|.||.|.|.:.::|:.|:|.|.|.||.:|.:|.|.|.:::.|..|:.:|:|.|||
Mouse   323 ------KLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPY 381

  Fly   378 SCKMCSKSFVQSNDLKIHMR----RHTGER 403
            .|..|...|...:.||.|:.    |.:||:
Mouse   382 KCHCCDMDFKHKSALKKHLTSVHGRSSGEK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 14/60 (23%)
C2H2 Zn finger 205..226 CDD:275368 7/42 (17%)
C2H2 Zn finger 249..266 CDD:275368 6/16 (38%)
COG5048 <294..>391 CDD:227381 28/96 (29%)
C2H2 Zn finger 296..315 CDD:275368 2/18 (11%)
zf-H2C2_2 307..330 CDD:290200 6/22 (27%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 10/23 (43%)
C2H2 Zn finger 379..399 CDD:275368 6/23 (26%)
zf-H2C2_2 391..416 CDD:290200 6/17 (35%)
C2H2 Zn finger 407..424 CDD:275368
Zbtb6NP_666365.1 BTB 23..123 CDD:279045 10/40 (25%)
BTB 34..127 CDD:197585 11/44 (25%)
C2H2 Zn finger 302..322 CDD:275368 8/61 (13%)
zf-C2H2 325..347 CDD:278523 8/21 (38%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-H2C2_2 339..363 CDD:290200 10/23 (43%)
C2H2 Zn finger 355..375 CDD:275368 6/19 (32%)
C2H2 Zn finger 383..400 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.