DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and PATZ1

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_055138.2 Gene:PATZ1 / 23598 HGNCID:13071 Length:687 Species:Homo sapiens


Alignment Length:390 Identity:91/390 - (23%)
Similarity:149/390 - (38%) Gaps:107/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 IYKCAVCPRVFAKSESLTRHFSQAHKLTA------DVAAMKLANESCGTGL-------------- 246
            |..|.:|.:||..:..|.:|.:| |.:|:      |:...:|..    .||              
Human   291 ILPCGLCGKVFTDANRLRQHEAQ-HGVTSLQLGYIDLPPPRLGE----NGLPISEDPDGPRKRSR 350

  Fly   247 ----LTCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRDCPHCGLSFP-VS 306
                :.||.|.:.|:....|.||..:...:                   |...||.|||.|. ..
Human   351 TRKQVACEICGKIFRDVYHLNRHKLSHSGE-------------------KPYSCPVCGLRFKRKD 396

  Fly   307 SLTIHIRRHTGD--NPYKCDQCEKAFPRSQDLSLHMRQ-HTGERPSECKICSKKFISQNKLARHM 368
            .::.|:|.|.|.  .||.|..|.|.|.|...|:.|::| ||.|||.:|:.|:..|.::::|..|:
Human   397 RMSYHVRSHDGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHL 461

  Fly   369 RLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH-RNRKG---- 428
            ..|..:.|  |::|.| ::::..:..|:::|:......|.:|...|...|:|.:| :...|    
Human   462 ACHEDKVP--CQVCGK-YLRAAYMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLP 523

  Fly   429 ----HLIAVIPGNEVEANFAADPYVNARVNQRRS-----------------EDIERMRLQ----- 467
                |...::.|.  .|...|..|.| :..|:.|                 .|::....|     
Human   524 QVSRHQEPILNGG--AAFHCARTYGN-KEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGS 585

  Fly   468 -----RIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALLTVHRNKMSHYEIERVYENPFG 527
                 .:|:|:::...|..         |.|..|...|:|.:.|..|..|: |.   |....|.|
Human   586 FSCDMAVPKNKMESDGEKK---------YPCPECGSFFRSKSYLNKHIQKV-HV---RALGGPLG 637

  Fly   528  527
            Human   638  637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 7/20 (35%)
C2H2 Zn finger 249..266 CDD:275368 6/16 (38%)
COG5048 <294..>391 CDD:227381 35/100 (35%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 9/24 (38%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
zf-H2C2_2 335..358 CDD:290200 10/23 (43%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 7/23 (30%)
C2H2 Zn finger 379..399 CDD:275368 4/19 (21%)
zf-H2C2_2 391..416 CDD:290200 5/24 (21%)
C2H2 Zn finger 407..424 CDD:275368 6/17 (35%)
PATZ1NP_055138.2 BTB_POZ_ZBTB19_PATZ1 14..162 CDD:349516
A-T hook domain 264..272
Zn finger DNA binding domain 294..628 86/373 (23%)
C2H2 Zn finger 294..314 CDD:275368 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-C2H2 357..377 CDD:395048 7/19 (37%)
COG5048 <381..518 CDD:227381 44/139 (32%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
C2H2 Zn finger 415..433 CDD:275368 7/17 (41%)
C2H2 Zn finger 444..464 CDD:275368 5/19 (26%)
C2H2 Zn finger 497..517 CDD:275368 6/19 (32%)
zf-C2H2_assoc3 536..604 CDD:406930 11/70 (16%)
C2H2 Zn finger 607..628 CDD:275370 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.