DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3281 and Zbtb7a

DIOPT Version :9

Sequence 1:	NP_650132.1	Gene:	CG3281 / 41445	FlyBaseID:	FBgn0260741	Length:	538	Species:	Drosophila melanogaster
Sequence 2:	XP_006513342.3	Gene:	Zbtb7a / 16969	MGIID:	1335091	Length:	725	Species:	Mus musculus

Alignment Length:	138	Identity:	61/138 - (44%)
Similarity:	76/138 - (55%)	Gaps:	14/138 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   322 KCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSF 386
            ||..|||....:..|..|:|.||||:|.||.||..:|..|:||..|||.|||::||.|:.|..:|
Mouse   533 KCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAF 597

  Fly   387 VQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH------------RNRKGHLIAVIPGNEV 439
            ..:.|||.|||.|||.|||||..|.::||...||:.|            |.||..:..|.|  :|
Mouse   598 AHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGVPP--DV 660

  Fly   440 EANFAADP 447
            .|...|.|
Mouse   661 PAGAGAPP 668

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3281	NP_650132.1	zf-AD	14..92	CDD:285071
		C2H2 Zn finger	205..226	CDD:275368
		C2H2 Zn finger	249..266	CDD:275368
		COG5048	<294..>391	CDD:227381	32/68 (47%)
		C2H2 Zn finger	296..315	CDD:275368
		zf-H2C2_2	307..330	CDD:290200	5/7 (71%)
		C2H2 Zn finger	323..343	CDD:275368	7/19 (37%)
		zf-H2C2_2	335..358	CDD:290200	12/22 (55%)
		C2H2 Zn finger	351..371	CDD:275368	10/19 (53%)
		zf-H2C2_2	364..388	CDD:290200	12/23 (52%)
		C2H2 Zn finger	379..399	CDD:275368	9/19 (47%)
		zf-H2C2_2	391..416	CDD:290200	16/24 (67%)
		C2H2 Zn finger	407..424	CDD:275368	7/28 (25%)
Zbtb7a	XP_006513342.3	BTB_POZ_ZBTB7A	165..284	CDD:349635
		C2H2 Zn finger	534..554	CDD:275368	7/19 (37%)
		zf-H2C2_2	549..571	CDD:404364	12/21 (57%)
		C2H2 Zn finger	562..582	CDD:275368	10/19 (53%)
		zf-H2C2_2	575..599	CDD:404364	12/23 (52%)
		C2H2 Zn finger	590..610	CDD:275368	9/19 (47%)
		zf-H2C2_2	602..627	CDD:404364	16/24 (67%)
		C2H2 Zn finger	618..636	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000