DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZNF582

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001307300.2 Gene:ZNF582 / 147948 HGNCID:26421 Length:517 Species:Homo sapiens


Alignment Length:425 Identity:115/425 - (27%)
Similarity:174/425 - (40%) Gaps:88/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDCSAFTSD--- 151
            :|.|::|:  ..||. |...: :|..:::.:..|:.|.:|.::....|:.:|...|   ..|   
Human   125 RNQFDRQQ--GNPDR-HFHQM-IIRHEEMPTFDQHASLTFYQKIHTREKPFGYNKC---RKDFWQ 182

  Fly   152 ----VGEEPLYASEDRDDEPEDSFQLKPRPDEIENRELSRPSQLGSRL-----NHSANFIYKCAV 207
                :..:.:|.:|            ||    .:.:|..:..:.||||     .||....|:|..
Human   183 KELLINHQGIYTNE------------KP----YKCKECGKAFKYGSRLIQHENIHSGKKPYECKE 231

  Fly   208 CPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQDTLRRHMQAFHPD 272
            |.:.|....:..:| .:.|               .|.....|:.|.:.|.|...|..|.:....:
Human   232 CGKAFNSGSNFIQH-QRVH---------------TGEKPYECKDCEKAFSRSSQLIEHQRTHTGE 280

  Fly   273 AIALEPEETTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDL 336
                               |...|..||.:| .:|.|.:|.|.|||:.||.|.:|.|.|.....|
Human   281 -------------------KPYQCKECGKAFNRISHLKVHYRIHTGEKPYACKECGKTFSHRSQL 326

  Fly   337 SLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTG 401
            ..|...|||.:..|||.|.|.|...:.|.||.|:|||::||.||:|.|:|..|:.||.|.|.|||
Human   327 IQHQTVHTGRKLYECKECGKAFNQGSTLIRHQRIHTGEKPYECKVCGKAFRVSSQLKQHQRIHTG 391

  Fly   402 ERPYQCGVCGESFVCGSHLNIH-RNRKG--------------HLIAVIPGNEVEANFAADPYVNA 451
            |:||||.|||.:|...|||.:| |...|              |...:|....:...  ..||...
Human   392 EKPYQCKVCGRAFKRVSHLTVHYRIHTGEKPYECKECGKAFSHCSQLIHHQVIHTE--KKPYEYK 454

  Fly   452 RVNQRRSEDIERMRLQRIPENQLQQRLENLPKPDV 486
            ...:..|.|...::.||:...:....:.|:.||.:
Human   455 ECEKTLSHDSTTVQPQRMHNRETHVNIINVEKPSI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 0/1 (0%)
C2H2 Zn finger 205..226 CDD:275368 4/20 (20%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 43/97 (44%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 11/22 (50%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 9/19 (47%)
zf-H2C2_2 364..388 CDD:290200 14/23 (61%)
C2H2 Zn finger 379..399 CDD:275368 10/19 (53%)
zf-H2C2_2 391..416 CDD:290200 16/24 (67%)
C2H2 Zn finger 407..424 CDD:275368 9/17 (53%)
ZNF582NP_001307300.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.