DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3281 and ZFP90

DIOPT Version :9

Sequence 1:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_016878441.1 Gene:ZFP90 / 146198 HGNCID:23329 Length:720 Species:Homo sapiens


Alignment Length:516 Identity:125/516 - (24%)
Similarity:191/516 - (37%) Gaps:169/516 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 HVEMEEKYG-----DQDCSAFTSDVGEEPLYASEDRDDEPEDSFQLKPRPDEIENRELS------ 186
            |..:|:.:.     |:....:...:|.|.  :::.:...|:::|:.....   ||..|:      
Human   198 HATLEDSWDVSSQLDRQQENWKRHLGSEA--STQKKIITPQENFEQNKFG---ENSRLNTNLVTQ 257

  Fly   187 -------RPSQ---LGSRLNHSANFI-----------YKCAVCPRVFAKSESLTRHFSQAHKLTA 230
                   |||:   |||.|.|:|:.:           |||..|.:.|....|||:| .:.||   
Human   258 LNIPARIRPSECETLGSNLGHNADLLNENNILAKKKPYKCDKCRKAFIHRSSLTKH-EKTHK--- 318

  Fly   231 DVAAMKLANESCGTGLL---------------TCEHCPRTFKRQDTLRRHMQAFHPDAIALEPEE 280
                        |.|..               .|..|.:||..:..|..| |..|..        
Human   319 ------------GEGAFPNGTDQGIYPGKKHHECTDCGKTFLWKTQLTEH-QRIHTG-------- 362

  Fly   281 TTDNSARKRIAKRRDCPHCGLSF-PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHT 344
                      .|..:|..||.:| ..|||..|...|||:.||:|..|.|||.||..|..|.|.||
Human   363 ----------EKPFECNVCGKAFRHSSSLGQHENAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHT 417

  Fly   345 GERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGV 409
            ||:|..|.:|.:.|.....|.:|...|:|::|:.||.|.|:|.:.:.|..|.|.||||:|::|.:
Human   418 GEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSI 482

  Fly   410 CGESFVCG------SHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRS---------- 458
            ||.:|  |      .|:.||:..|.:         ..:|::.|...:..:.|..|          
Human   483 CGRAF--GQSPSLYKHMRIHKRGKPY---------QSSNYSIDFKHSTSLTQDESTLTEVKSYHC 536

  Fly   459 -------------EDIERMRLQRIP---ENQLQQRLENLP--KPDVPAMCYKCGVCEQKFKSGAL 505
                         .|.:|:.....|   |....|:..:.|  ||      |:|.||.:.||....
Human   537 NDCGEDFSHITDFTDHQRIHTAENPYDCEQAFSQQAISHPGEKP------YQCNVCGKAFKRSTS 595

  Fly   506 LTVH---------------------RNKMSHYEIERVYENP---------FGKNQKIIKAE 536
            ...|                     |:.::.:|.....|.|         |.::..:|:.|
Human   596 FIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECIDCGKAFSQSSSLIQHE 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 7/20 (35%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 41/97 (42%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 11/22 (50%)
C2H2 Zn finger 323..343 CDD:275368 10/19 (53%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 10/23 (43%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 12/24 (50%)
C2H2 Zn finger 407..424 CDD:275368 7/22 (32%)
ZFP90XP_016878441.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.