DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3281 and Zbtb7a

DIOPT Version :9

Sequence 1:	NP_650132.1	Gene:	CG3281 / 41445	FlyBaseID:	FBgn0260741	Length:	538	Species:	Drosophila melanogaster
Sequence 2:	XP_006240898.1	Gene:	Zbtb7a / 117107	RGDID:	620946	Length:	648	Species:	Rattus norvegicus

Alignment Length:	138	Identity:	60/138 - (43%)
Similarity:	76/138 - (55%)	Gaps:	14/138 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   322 KCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSF 386
            ||..|||....:..|..|:|.||||:|.||.||..:|..|:||..|||.|||::||.|:.|..:|
  Rat   456 KCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAF 520

  Fly   387 VQSNDLKIHMRRHTGERPYQCGVCGESFVCGSHLNIH------------RNRKGHLIAVIPGNEV 439
            ..:.|||.|||.|||.|||||..|.::||...||:.|            |.||..:..|.|  :|
  Rat   521 AHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGVPP--DV 583

  Fly   440 EANFAADP 447
            .:...|.|
  Rat   584 PSGAGAPP 591

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3281	NP_650132.1	zf-AD	14..92	CDD:285071
		C2H2 Zn finger	205..226	CDD:275368
		C2H2 Zn finger	249..266	CDD:275368
		COG5048	<294..>391	CDD:227381	32/68 (47%)
		C2H2 Zn finger	296..315	CDD:275368
		zf-H2C2_2	307..330	CDD:290200	5/7 (71%)
		C2H2 Zn finger	323..343	CDD:275368	7/19 (37%)
		zf-H2C2_2	335..358	CDD:290200	12/22 (55%)
		C2H2 Zn finger	351..371	CDD:275368	10/19 (53%)
		zf-H2C2_2	364..388	CDD:290200	12/23 (52%)
		C2H2 Zn finger	379..399	CDD:275368	9/19 (47%)
		zf-H2C2_2	391..416	CDD:290200	16/24 (67%)
		C2H2 Zn finger	407..424	CDD:275368	7/28 (25%)
Zbtb7a	XP_006240898.1	BTB	103..206	CDD:279045
		BTB	114..210	CDD:197585
		COG5048	455..>518	CDD:227381	31/61 (51%)
		C2H2 Zn finger	457..477	CDD:275368	7/19 (37%)
		zf-H2C2_2	472..494	CDD:290200	12/21 (57%)
		C2H2 Zn finger	485..505	CDD:275368	10/19 (53%)
		zf-H2C2_2	498..522	CDD:290200	12/23 (52%)
		C2H2 Zn finger	513..533	CDD:275368	9/19 (47%)
		zf-H2C2_2	525..550	CDD:290200	16/24 (67%)
		C2H2 Zn finger	541..559	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000